PDB entry 3phz

View 3phz on RCSB PDB site
Description: Crystal Structure Analysis of Polyporus squamosus lectin bound to human-type influenza-binding epitope Neu5Aca2-6Galb1-4GlcNAc
Class: sugar binding protein
Keywords: Beta trefoil, Saccharide binding lectin, 2,6-Sialyl-lactosamine, SUGAR BINDING PROTEIN
Deposited on 2010-11-04, released 2011-07-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-06, with a file datestamp of 2011-07-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.187
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ricin B-related lectin
    Species: Polyporus squamosus [TaxId:5640]
    Gene: psl1a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3phza1, d3phza2
  • Chain 'B':
    Compound: Ricin B-related lectin
    Species: Polyporus squamosus [TaxId:5640]
    Gene: psl1a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3phzb1, d3phzb2
  • Heterogens: SIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3phzA (A:)
    msfqghgiyyiasayvantrlalsedssankspdviissdavdplnnlwliepvgeadty
    tvrnafagsymdlaghaatdgtaiigyrptggdnqkwiisqindvwkiksketgtfvtll
    ngdgggtgtvvgwqnitnntsqnwtfqklsqtganvhatllacpalrqdfksylsdglyl
    vltrdqissiwqasglgstpwrseifdcddfatvfkgavakwgnenfkangfallcglmf
    gskssgahaynwfvergnfstvtffepqngtysanawdykayfglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3phzA (A:)
    sfqghgiyyiasayvantrlalsenkspdviissdavdplnnlwliepvgeadtytvrna
    fagsymdlaghaatdgtaiigyrptggdnqkwiisqindvwkiksketgtfvtllnggtg
    tvvgwqnitnntsqnwtfqklsqtganvhatllacpalrqdfksylsdglylvltrdqis
    siwqasglgstpwrseifdcddfatvfkgavakwgnenfkangfallcglmfgskssgah
    aynwfvergnfstvtffepqngtysanawdykayfglf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3phzB (B:)
    msfqghgiyyiasayvantrlalsedssankspdviissdavdplnnlwliepvgeadty
    tvrnafagsymdlaghaatdgtaiigyrptggdnqkwiisqindvwkiksketgtfvtll
    ngdgggtgtvvgwqnitnntsqnwtfqklsqtganvhatllacpalrqdfksylsdglyl
    vltrdqissiwqasglgstpwrseifdcddfatvfkgavakwgnenfkangfallcglmf
    gskssgahaynwfvergnfstvtffepqngtysanawdykayfglf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3phzB (B:)
    sfqghgiyyiasayvantrlalsenkspdviissdavdplnnlwliepvgeadtytvrna
    fagsymdlaghaatdgtaiigyrptggdnqkwiisqindvwkiksketgtfvtllnggtg
    tvvgwqnitnntsqnwtfqklsqtganvhatllacpalrqdfksylsdglylvltrdqis
    siwqasglgstpwrseifdcddfatvfkgavakwgnenfkangfallcglmfgskssgah
    aynwfvergnfstvtffepqngtysanawdykayfglf