PDB entry 3ph2

View 3ph2 on RCSB PDB site
Description: Structure of the imidazole-adduct of the Phormidium laminosum cytochrome c6 Q51V variant
Class: photosynthesis
Keywords: Class I cytochrome c, Photosynthesis, Cytochrome f, Photosystem I, Thylakoid
Deposited on 2010-11-03, released 2011-02-09
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-08-10, with a file datestamp of 2011-08-05.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.188
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: cytochrome c6
    Species: Phormidium laminosum [TaxId:32059]
    Database cross-references and differences (RAF-indexed):
    • PDB 3PH2 (Start-85)
    Domains in SCOPe 2.02: d3ph2b_
  • Heterogens: HEM, IMD, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ph2B (B:)
    dadlatgakvfsancaachagginlvnaektlkkealekfgmnsivaittvvtngkagmp
    afkgrltddqiaavaayvldqaekgw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ph2B (B:)
    adlatgakvfsancaachagginlvnaektlkkealekfgmnsivaittvvtngkagmpa
    fkgrltddqiaavaayvldqaekgw