PDB entry 3pgt

View 3pgt on RCSB PDB site
Description:
Deposited on 1999-03-22, released 1999-09-01
The last revision prior to the SCOP 1.67 freeze date was dated 2001-01-10, with a file datestamp of 2001-01-10.
Experiment type: XRAY
Resolution: 2.14 Å
R-factor: 0.156
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d3pgta1, d3pgta2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d3pgtb1, d3pgtb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3pgtA (A:)
    mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgd
    ltlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyv
    kalpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsay
    vgrlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pgtB (B:)
    mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgd
    ltlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyv
    kalpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsay
    vgrlsarpklkaflaspeyvnlpingngkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pgtB (B:)
    ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
    tlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvk
    alpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayv
    grlsarpklkaflaspeyvnlpingngkq