PDB entry 3pg8

View 3pg8 on RCSB PDB site
Description: Truncated form of 3-deoxy-D-arabino-heptulosonate 7-phosphate synthase from Thermotoga maritima
Class: Transferase
Keywords: Thermotoga maritima, DAH7PS, Shikimate pathway, aromatic biosynthesis, transferase, Tim barrel
Deposited on 2010-10-31, released 2011-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.158
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: aroF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYH8 (4-271)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d3pg8a1, d3pg8a2
  • Chain 'B':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: aroF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYH8 (4-271)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d3pg8b1, d3pg8b2
  • Heterogens: GOL, AZI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pg8A (A:)
    gsftlvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflselgvkvlr
    ggaykprtspysfqglgekgleylreaadkygmyvvtealgeddlpkvaeyadiiqigar
    naqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergirtfekat
    rntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevhpepeka
    lsdgkqsldfelfkelvqemkkladalgvkvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pg8A (A:)
    gsftlvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflselgvkvlr
    ggaykprglgekgleylreaadkygmyvvtealgeddlpkvaeyadiiqigarnaqnfrl
    lskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergirtfekatrntldis
    avpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevhpepekalsdgkqs
    ldfelfkelvqemkkladalgvkvn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pg8B (B:)
    gsftlvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflselgvkvlr
    ggaykprtspysfqglgekgleylreaadkygmyvvtealgeddlpkvaeyadiiqigar
    naqnfrllskagsynkpvllkrgfmntieefllsaeyiansgntkiilcergirtfekat
    rntldisavpiirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevhpepeka
    lsdgkqsldfelfkelvqemkkladalgvkvn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pg8B (B:)
    gsftlvsrefhpedtvidlgdvkigngyftiiagpcsvegremlmetahflselgvkvlr
    ggayklgekgleylreaadkygmyvvtealgeddlpkvaeyadiiqigarnaqnfrllsk
    agsynkpvllkrgfmntieefllsaeyiansgntkiilcergirtfekatrntldisavp
    iirkeshlpilvdpshsggrrdlviplsraaiavgahgiivevhpepekalsdgkqsldf
    elfkelvqemkkladalgvkvn