PDB entry 3pfr

View 3pfr on RCSB PDB site
Description: Crystal structure of D-Glucarate dehydratase related protein from Actinobacillus Succinogenes complexed with D-Glucarate
Class: isomerase
Keywords: Emolase superfamily fold, D-Glucarate dehydratase, D-Glucarate, ISOMERASE
Deposited on 2010-10-29, released 2011-11-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.218
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Actinobacillus succinogenes [TaxId:67854]
    Gene: Asuc_1852
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pfra1, d3pfra2
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Actinobacillus succinogenes [TaxId:67854]
    Gene: Asuc_1852
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pfrb1, d3pfrb2
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Actinobacillus succinogenes [TaxId:67854]
    Gene: Asuc_1852
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pfrc1, d3pfrc2
  • Chain 'D':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Actinobacillus succinogenes [TaxId:67854]
    Gene: Asuc_1852
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3pfrd1, d3pfrd2
  • Heterogens: MG, GKR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pfrA (A:)
    mslstqsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapgga
    tienalteaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaa
    lldlmgqflgvpvaellgpgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirr
    kkamdtqavielaaaskdrygfkdfklkggvfegskeidtvielkkhfpdaritldpngc
    wsldeaiqlckglndvltyaedpcigengysgreimaefrrrtgiptatnmiatnwremc
    haimlqsvdipladphfwtltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaap
    gnptaldthwiwqegdfyltknpleikdgkiklndkpglgielnmdnvlkahelhkklpn
    garndaipmqfyypgwkfdrkrpamvreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pfrA (A:)
    svpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienal
    teaiphvvgrpisilnkivndmhntfelrvnavaaleaalldlmgqflgvpvaellgpgk
    qrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirrkkamdtqavielaaaskdryg
    fkdfklkggvfegskeidtvielkkhfpdaritldpngcwsldeaiqlckglndvltyae
    dpcigengysgreimaefrrrtgiptatnmiatnwremchaimlqsvdipladphfwtlt
    gasrvaqlcnewgltwgchsnnhfdislamfshvgaaapgnptaldthwiwqegdfyltk
    npleikdgkiklndkpglgielnmdnvlkahelhkklpngarndaipmqfyypgwkfdrk
    rpamvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pfrB (B:)
    mslstqsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapgga
    tienalteaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaa
    lldlmgqflgvpvaellgpgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirr
    kkamdtqavielaaaskdrygfkdfklkggvfegskeidtvielkkhfpdaritldpngc
    wsldeaiqlckglndvltyaedpcigengysgreimaefrrrtgiptatnmiatnwremc
    haimlqsvdipladphfwtltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaap
    gnptaldthwiwqegdfyltknpleikdgkiklndkpglgielnmdnvlkahelhkklpn
    garndaipmqfyypgwkfdrkrpamvreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pfrB (B:)
    svpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienal
    teaiphvvgrpisilnkivndmhntfelrvnavaaleaalldlmgqflgvpvaellgpgk
    qrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirrkkamdtqavielaaaskdryg
    fkdfklkggvfegskeidtvielkkhfpdaritldpngcwsldeaiqlckglndvltyae
    dpcigengysgreimaefrrrtgiptatnmiatnwremchaimlqsvdipladphfwtlt
    gasrvaqlcnewgltwgchsnnhfdislamfshvgaaapgnptaldthwiwqegdfyltk
    npleikdgkiklndkpglgielnmdnvlkahelhkklpngarndaipmqfyypgwkfdrk
    rpamvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pfrC (C:)
    mslstqsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapgga
    tienalteaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaa
    lldlmgqflgvpvaellgpgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirr
    kkamdtqavielaaaskdrygfkdfklkggvfegskeidtvielkkhfpdaritldpngc
    wsldeaiqlckglndvltyaedpcigengysgreimaefrrrtgiptatnmiatnwremc
    haimlqsvdipladphfwtltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaap
    gnptaldthwiwqegdfyltknpleikdgkiklndkpglgielnmdnvlkahelhkklpn
    garndaipmqfyypgwkfdrkrpamvreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pfrC (C:)
    svpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienal
    teaiphvvgrpisilnkivndmhntfelrvnavaaleaalldlmgqflgvpvaellgpgk
    qrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirrkkamdtqavielaaaskdryg
    fkdfklkggvfegskeidtvielkkhfpdaritldpngcwsldeaiqlckglndvltyae
    dpcigengysgreimaefrrrtgiptatnmiatnwremchaimlqsvdipladphfwtlt
    gasrvaqlcnewgltwgchsnnhfdislamfshvgaaapgnptaldthwiwqegdfyltk
    npleikdgkiklndkpglgielnmdnvlkahelhkklpngarndaipmqfyypgwkfdrk
    rpamvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3pfrD (D:)
    mslstqsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapgga
    tienalteaiphvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaa
    lldlmgqflgvpvaellgpgkqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirr
    kkamdtqavielaaaskdrygfkdfklkggvfegskeidtvielkkhfpdaritldpngc
    wsldeaiqlckglndvltyaedpcigengysgreimaefrrrtgiptatnmiatnwremc
    haimlqsvdipladphfwtltgasrvaqlcnewgltwgchsnnhfdislamfshvgaaap
    gnptaldthwiwqegdfyltknpleikdgkiklndkpglgielnmdnvlkahelhkklpn
    garndaipmqfyypgwkfdrkrpamvreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pfrD (D:)
    svpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienal
    teaiphvvgrpisilnkivndmhntfelrvnavaaleaalldlmgqflgvpvaellgpgk
    qrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirrkkamdtqavielaaaskdryg
    fkdfklkggvfegskeidtvielkkhfpdaritldpngcwsldeaiqlckglndvltyae
    dpcigengysgreimaefrrrtgiptatnmiatnwremchaimlqsvdipladphfwtlt
    gasrvaqlcnewgltwgchsnnhfdislamfshvgaaapgnptaldthwiwqegdfyltk
    npleikdgkiklndkpglgielnmdnvlkahelhkklpngarndaipmqfyypgwkfdrk
    rpamvr