PDB entry 3pfi

View 3pfi on RCSB PDB site
Description: 2.7 Angstrom resolution crystal structure of a probable holliday junction DNA helicase (ruvB) from Campylobacter jejuni subsp. jejuni NCTC 11168 in complex with adenosine-5'-diphosphate
Class: hydrolase
Keywords: Probable Holliday Junction DNA Helicase, Center for Structural Genomics of Infectious Diseases, CSGID, PS00017 ATP/GTP-binding site motif A/Helicase, HYDROLASE
Deposited on 2010-10-28, released 2010-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Holliday junction ATP-dependent DNA helicase ruvB
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: CJJ8425_1444, ruvB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pfia1, d3pfia2
  • Chain 'B':
    Compound: Holliday junction ATP-dependent DNA helicase ruvB
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: CJJ8425_1444, ruvB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pfib1, d3pfib2
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pfiA (A:)
    snamdriveiekysfdetyetslrpsnfdgyigqesikknlnvfiaaakkrnecldhilf
    sgpaglgkttlaniisyemsanikttaapmieksgdlaailtnlsegdilfideihrlsp
    aieevlypamedyrldiiigsgpaaqtikidlpkftligattragmlsnplrdrfgmqfr
    lefykdselalilqkaalklnktceekaaleiakrsrstprialrllkrvrdfadvndee
    iitekranealnslgvnelgfdamdlrylelltaakqkpiglasiaaalsedentiedvi
    epyllangyiertakgriasaksysalklnyektlfee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pfiA (A:)
    lrpsnfdgyigqesikknlnvfiaaakkrnecldhilfsgpaglgkttlaniisyemsan
    ikttaapmieksgdlaailtnlsegdilfideihrlspaieevlypamedyrlaqtikid
    lpkftligattragmlsnplrdrfgmqfrlefykdselalilqkaalklnktceekaale
    iakrsrstprialrllkrvrdfadvndeeiitekranealnslgvnelgfdamdlrylel
    ltaakqkpiglasiaaalsedentiedviepyllangyiertakgriasaksysalklny
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pfiB (B:)
    snamdriveiekysfdetyetslrpsnfdgyigqesikknlnvfiaaakkrnecldhilf
    sgpaglgkttlaniisyemsanikttaapmieksgdlaailtnlsegdilfideihrlsp
    aieevlypamedyrldiiigsgpaaqtikidlpkftligattragmlsnplrdrfgmqfr
    lefykdselalilqkaalklnktceekaaleiakrsrstprialrllkrvrdfadvndee
    iitekranealnslgvnelgfdamdlrylelltaakqkpiglasiaaalsedentiedvi
    epyllangyiertakgriasaksysalklnyektlfee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pfiB (B:)
    snfdgyigqesikknlnvfiaaakkrnecldhilfsgpaglgkttlaniisyemsanikt
    taapmieksgdlaailtnlsegdilfideihrlspaieevlypamedypkftligattra
    gmlsnplrdrfgmqfrlefykdselalilqkaalklnktceekaaleiakrsrstprial
    rllkrvrdfadvndeeiitekranealnslgvnelgfdamdlrylelltaakqkpiglas
    iaaalsedentiedviepyllangyiertakgriasaksysal