PDB entry 3pfd

View 3pfd on RCSB PDB site
Description: Crystal structure of an Acyl-CoA dehydrogenase from Mycobacterium thermoresistibile bound to reduced flavin adenine dinucleotide solved by combined iodide ion SAD MR
Class: oxidoreductase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, dehydrogenase, de novo phase determination, iodide ion SAD, acyl coA dehydrogenase, reduced flavin adenine dinucleotide, FAD, fatty acid metabolism, OXIDOREDUCTASE
Deposited on 2010-10-28, released 2010-11-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA dehydrogenase
    Species: Mycobacterium thermoresistibile [TaxId:1797]
    Database cross-references and differences (RAF-indexed):
    • PDB 3PFD (Start-392)
    Domains in SCOPe 2.06: d3pfda1, d3pfda2
  • Chain 'B':
    Compound: acyl-CoA dehydrogenase
    Species: Mycobacterium thermoresistibile [TaxId:1797]
    Database cross-references and differences (RAF-indexed):
    • PDB 3PFD (Start-392)
    Domains in SCOPe 2.06: d3pfdb1, d3pfdb2
  • Chain 'C':
    Compound: acyl-CoA dehydrogenase
    Species: Mycobacterium thermoresistibile [TaxId:1797]
    Database cross-references and differences (RAF-indexed):
    • PDB 3PFD (Start-392)
    Domains in SCOPe 2.06: d3pfdc1, d3pfdc2
  • Chain 'D':
    Compound: acyl-CoA dehydrogenase
    Species: Mycobacterium thermoresistibile [TaxId:1797]
    Database cross-references and differences (RAF-indexed):
    • PDB 3PFD (Start-392)
    Domains in SCOPe 2.06: d3pfdd1, d3pfdd2
  • Heterogens: FDA, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pfdA (A:)
    gpgsmaawsgnpsfelfqlpeehialreairalaekeiapyaaevdekarfpeealaaln
    ssgfsaihvpeeyggqgadsvatcivieevarvdcsaslipavnklgtmglilrgseelk
    kqvlpavasgeamasyalsereagsdaasmrtravadgddwilngskcwitnggkstwyt
    vmavtdpdkgangisafmvhkddegftvgpkerklgikgspttelyfencripgdriige
    pgtgfktalatldhtrptigaqavgiaqgaldaaiaytkerkqfgrpvsdnqgvqfmlad
    mamkieaarlmvysaaaraergegdlgfisaaskcfasdvamevttdavqlfggygytqd
    fpvermmrdakitqiyegtnqiqrvvmsrallr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pfdA (A:)
    ehialreairalaekeiapyaaevdekarfpeealaalnssgfsaihvpeeyggqgadsv
    atcivieevarvdcsaslipavnklgtmglilrgseelkkqvlpavasgeamasyalser
    eagsdaasmrtravadgddwilngskcwitnggkstwytvmavtdpdkgangisafmvhk
    ddegftvgpkerklgikgspttelyfencripgdriigepgtgfktalatldhtrptiga
    qavgiaqgaldaaiaytkerkqfgrpvsdnqgvqfmladmamkieaarlmvysaaaraer
    ggfisaaskcfasdvamevttdavqlfggygytqdfpvermmrdakitqiyegtnqiqrv
    vmsrallr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pfdB (B:)
    gpgsmaawsgnpsfelfqlpeehialreairalaekeiapyaaevdekarfpeealaaln
    ssgfsaihvpeeyggqgadsvatcivieevarvdcsaslipavnklgtmglilrgseelk
    kqvlpavasgeamasyalsereagsdaasmrtravadgddwilngskcwitnggkstwyt
    vmavtdpdkgangisafmvhkddegftvgpkerklgikgspttelyfencripgdriige
    pgtgfktalatldhtrptigaqavgiaqgaldaaiaytkerkqfgrpvsdnqgvqfmlad
    mamkieaarlmvysaaaraergegdlgfisaaskcfasdvamevttdavqlfggygytqd
    fpvermmrdakitqiyegtnqiqrvvmsrallr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pfdB (B:)
    ehialreairalaekeiapyaaevdekarfpeealaalnssgfsaihvpeeyggqgadsv
    atcivieevarvdcsaslipavnklgtmglilrgseelkkqvlpavasgeamasyalser
    eagsdaasmrtravadgddwilngskcwitnggkstwytvmavtdpdkgangisafmvhk
    ddegftvgpkerklgikgspttelyfencripgdriigepgtgfktalatldhtrptiga
    qavgiaqgaldaaiaytkerkqfgrpvsdnqgvqfmladmamkieaarlmvysaaaraer
    ggfisaaskcfasdvamevttdavqlfggygytqdfpvermmrdakitqiyegtnqiqrv
    vmsrallr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pfdC (C:)
    gpgsmaawsgnpsfelfqlpeehialreairalaekeiapyaaevdekarfpeealaaln
    ssgfsaihvpeeyggqgadsvatcivieevarvdcsaslipavnklgtmglilrgseelk
    kqvlpavasgeamasyalsereagsdaasmrtravadgddwilngskcwitnggkstwyt
    vmavtdpdkgangisafmvhkddegftvgpkerklgikgspttelyfencripgdriige
    pgtgfktalatldhtrptigaqavgiaqgaldaaiaytkerkqfgrpvsdnqgvqfmlad
    mamkieaarlmvysaaaraergegdlgfisaaskcfasdvamevttdavqlfggygytqd
    fpvermmrdakitqiyegtnqiqrvvmsrallr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pfdC (C:)
    hialreairalaekeiapyaaevdekarfpeealaalnssgfsaihvpeeyggqgadsva
    tcivieevarvdcsaslipavnklgtmglilrgseelkkqvlpavasgeamasyalsere
    agsdaasmrtravadgddwilngskcwitnggkstwytvmavtdpdkgangisafmvhkd
    degftvgpkerklgikgspttelyfencripgdriigepgtgfktalatldhtrptigaq
    avgiaqgaldaaiaytkerkqfgrpvsdnqgvqfmladmamkieaarlmvysaaaraerg
    dlgfisaaskcfasdvamevttdavqlfggygytqdfpvermmrdakitqiyegtnqiqr
    vvmsrallr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3pfdD (D:)
    gpgsmaawsgnpsfelfqlpeehialreairalaekeiapyaaevdekarfpeealaaln
    ssgfsaihvpeeyggqgadsvatcivieevarvdcsaslipavnklgtmglilrgseelk
    kqvlpavasgeamasyalsereagsdaasmrtravadgddwilngskcwitnggkstwyt
    vmavtdpdkgangisafmvhkddegftvgpkerklgikgspttelyfencripgdriige
    pgtgfktalatldhtrptigaqavgiaqgaldaaiaytkerkqfgrpvsdnqgvqfmlad
    mamkieaarlmvysaaaraergegdlgfisaaskcfasdvamevttdavqlfggygytqd
    fpvermmrdakitqiyegtnqiqrvvmsrallr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pfdD (D:)
    ehialreairalaekeiapyaaevdekarfpeealaalnssgfsaihvpeeyggqgadsv
    atcivieevarvdcsaslipavnklgtmglilrgseelkkqvlpavasgeamasyalser
    eagsdaasmrtravadgddwilngskcwitnggkstwytvmavtdpdkgangisafmvhk
    ddegftvgpkerklgikgspttelyfencripgdriigepgtgfktalatldhtrptiga
    qavgiaqgaldaaiaytkerkqfgrpvsdnqgvqfmladmamkieaarlmvysaaaraer
    glgfisaaskcfasdvamevttdavqlfggygytqdfpvermmrdakitqiyegtnqiqr
    vvmsrallr