PDB entry 3peq

View 3peq on RCSB PDB site
Description: PPARd complexed with a phenoxyacetic acid partial agonist
Class: TRANSCRIPTION/TRANSCRIPTION agonist
Keywords: PPAR nuclear receptor, TRANSCRIPTION-TRANSCRIPTION agonist complex
Deposited on 2010-10-27, released 2011-10-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.201
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1C2, PPARB, PPARD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3peqa_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: NR1C2, PPARB, PPARD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3peqb_
  • Heterogens: 3EQ, JZR, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3peqA (A:)
    qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkq
    lvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheai
    famlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlal
    fiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlv
    tehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3peqA (A:)
    adlkafskhiynaylknfnmtkkkarsiltapfvihdietlwqaekglvwlppykeisvh
    vfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdgll
    vangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrpgl
    mnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqrikkte
    tetslhpllqeiykd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3peqB (B:)
    qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkq
    lvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheai
    famlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlal
    fiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlv
    tehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3peqB (B:)
    adlkafskhiynaylknfnmtkkkarsiltapfvihdietlwqaekglvwlppykeisvh
    vfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnkdgll
    vangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgdrpgl
    mnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqrikkte
    tetslhpllqeiykdmy