PDB entry 3pdi

View 3pdi on RCSB PDB site
Description: Precursor bound NifEN
Class: protein binding
Keywords: Nitrogenase Cofactor maturation, NifB, NifDK, NifH, PROTEIN BINDING
Deposited on 2010-10-22, released 2011-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.299
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrogenase MoFe cofactor biosynthesis protein NifE
    Species: Azotobacter vinelandii [TaxId:322710]
    Gene: Avin_01450, nifE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pdia_
  • Chain 'B':
    Compound: Nitrogenase MoFe cofactor biosynthesis protein NifN
    Species: Azotobacter vinelandii [TaxId:322710]
    Gene: Avin_01470, nifN
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Nitrogenase MoFe cofactor biosynthesis protein NifE
    Species: Azotobacter vinelandii [TaxId:322710]
    Gene: Avin_01450, nifE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pdic_
  • Chain 'D':
    Compound: Nitrogenase MoFe cofactor biosynthesis protein NifN
    Species: Azotobacter vinelandii [TaxId:322710]
    Gene: Avin_01470, nifN
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Nitrogenase MoFe cofactor biosynthesis protein NifE
    Species: Azotobacter vinelandii [TaxId:322710]
    Gene: Avin_01450, nifE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pdie_
  • Chain 'F':
    Compound: Nitrogenase MoFe cofactor biosynthesis protein NifN
    Species: Azotobacter vinelandii [TaxId:322710]
    Gene: Avin_01470, nifN
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Nitrogenase MoFe cofactor biosynthesis protein NifE
    Species: Azotobacter vinelandii [TaxId:322710]
    Gene: Avin_01450, nifE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3pdig_
  • Chain 'H':
    Compound: Nitrogenase MoFe cofactor biosynthesis protein NifN
    Species: Azotobacter vinelandii [TaxId:322710]
    Gene: Avin_01470, nifN
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SF4, CZL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pdiA (A:)
    mhhhhhhhmkakdiaelldepacshnkkeksgcakpkpgatdggcsfdgaqiallpvadv
    ahivhgpiacagsswdnrgtrssgpdlyrigmttdltendvimgraekrlfhairqaves
    ysppavfvyntcvpaligddvdavckaaaerfgtpvipvdsagfygtknlgnriageaml
    kyvigtrepdplpvgserpgirvhdvnligeyniagefwhvlplldelglrvlctlagda
    ryrevqtmhraevnmmvcskamlnvarklqetygtpwfegsfygitdtsqalrdfarlld
    dpdltartealiareeakvraalepwrarlegkrvllytggvkswsvvsalqdlgmkvva
    tgtkksteedkarirelmgddvkmldegnarvllktvdeyqadiliaggrnmytalkgrv
    pfldinqerefgyagydgmlelvrqlcitlecpvweavrrpapwdipasqdaapsapars
    ana
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pdiA (A:)
    gcakpkpgatdggcsfdgaqiallpvadvahivhgpiacagsswdnrgtrssgpdlyrig
    mttdltendvimgraekrlfhairqavesysppavfvyntcvpaligddvdavckaaaer
    fgtpvipvdsagfygtknlgnriageamlkyvigtrepdplpvgserpgirvhdvnlige
    yniagefwhvlplldelglrvlctlagdaryrevqtmhraevnmmvcskamlnvarklqe
    tygtpwfegsfygitdtsqalrdfarllddpdltartealiareeakvraalepwrarle
    gkrvllytggvkswsvvsalqdlgmkvvatgtkksteedkarirelmgddvkmldegnar
    vllktvdeyqadiliaggrnmytalkgrvpfldinqerefgyagydgmlelvrqlcitle
    cpvweav
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3pdiC (C:)
    mhhhhhhhmkakdiaelldepacshnkkeksgcakpkpgatdggcsfdgaqiallpvadv
    ahivhgpiacagsswdnrgtrssgpdlyrigmttdltendvimgraekrlfhairqaves
    ysppavfvyntcvpaligddvdavckaaaerfgtpvipvdsagfygtknlgnriageaml
    kyvigtrepdplpvgserpgirvhdvnligeyniagefwhvlplldelglrvlctlagda
    ryrevqtmhraevnmmvcskamlnvarklqetygtpwfegsfygitdtsqalrdfarlld
    dpdltartealiareeakvraalepwrarlegkrvllytggvkswsvvsalqdlgmkvva
    tgtkksteedkarirelmgddvkmldegnarvllktvdeyqadiliaggrnmytalkgrv
    pfldinqerefgyagydgmlelvrqlcitlecpvweavrrpapwdipasqdaapsapars
    ana
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pdiC (C:)
    gcakpkpgatdggcsfdgaqiallpvadvahivhgpiacagsswdnrgtrssgpdlyrig
    mttdltendvimgraekrlfhairqavesysppavfvyntcvpaligddvdavckaaaer
    fgtpvipvdsagfygtknlgnriageamlkyvigtrepdplpvgserpgirvhdvnlige
    yniagefwhvlplldelglrvlctlagdaryrevqtmhraevnmmvcskamlnvarklqe
    tygtpwfegsfygitdtsqalrdfarllddpdltartealiareeakvraalepwrarle
    gkrvllytggvkswsvvsalqdlgmkvvatgtkksteedkarirelmgddvkmldegnar
    vllktvdeyqadiliaggrnmytalkgrvpfldinqerefgyagydgmlelvrqlcitle
    cpvweav
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3pdiE (E:)
    mhhhhhhhmkakdiaelldepacshnkkeksgcakpkpgatdggcsfdgaqiallpvadv
    ahivhgpiacagsswdnrgtrssgpdlyrigmttdltendvimgraekrlfhairqaves
    ysppavfvyntcvpaligddvdavckaaaerfgtpvipvdsagfygtknlgnriageaml
    kyvigtrepdplpvgserpgirvhdvnligeyniagefwhvlplldelglrvlctlagda
    ryrevqtmhraevnmmvcskamlnvarklqetygtpwfegsfygitdtsqalrdfarlld
    dpdltartealiareeakvraalepwrarlegkrvllytggvkswsvvsalqdlgmkvva
    tgtkksteedkarirelmgddvkmldegnarvllktvdeyqadiliaggrnmytalkgrv
    pfldinqerefgyagydgmlelvrqlcitlecpvweavrrpapwdipasqdaapsapars
    ana
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pdiE (E:)
    gcakpkpgatdggcsfdgaqiallpvadvahivhgpiacagsswdnrgtrssgpdlyrig
    mttdltendvimgraekrlfhairqavesysppavfvyntcvpaligddvdavckaaaer
    fgtpvipvdsagfygtknlgnriageamlkyvigtrepdplpvgserpgirvhdvnlige
    yniagefwhvlplldelglrvlctlagdaryrevqtmhraevnmmvcskamlnvarklqe
    tygtpwfegsfygitdtsqalrdfarllddpdltartealiareeakvraalepwrarle
    gkrvllytggvkswsvvsalqdlgmkvvatgtkksteedkarirelmgddvkmldegnar
    vllktvdeyqadiliaggrnmytalkgrvpfldinqerefgyagydgmlelvrqlcitle
    cpvweav
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3pdiG (G:)
    mhhhhhhhmkakdiaelldepacshnkkeksgcakpkpgatdggcsfdgaqiallpvadv
    ahivhgpiacagsswdnrgtrssgpdlyrigmttdltendvimgraekrlfhairqaves
    ysppavfvyntcvpaligddvdavckaaaerfgtpvipvdsagfygtknlgnriageaml
    kyvigtrepdplpvgserpgirvhdvnligeyniagefwhvlplldelglrvlctlagda
    ryrevqtmhraevnmmvcskamlnvarklqetygtpwfegsfygitdtsqalrdfarlld
    dpdltartealiareeakvraalepwrarlegkrvllytggvkswsvvsalqdlgmkvva
    tgtkksteedkarirelmgddvkmldegnarvllktvdeyqadiliaggrnmytalkgrv
    pfldinqerefgyagydgmlelvrqlcitlecpvweavrrpapwdipasqdaapsapars
    ana
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pdiG (G:)
    gcakpkpgatdggcsfdgaqiallpvadvahivhgpiacagsswdnrgtrssgpdlyrig
    mttdltendvimgraekrlfhairqavesysppavfvyntcvpaligddvdavckaaaer
    fgtpvipvdsagfygtknlgnriageamlkyvigtrepdplpvgserpgirvhdvnlige
    yniagefwhvlplldelglrvlctlagdaryrevqtmhraevnmmvcskamlnvarklqe
    tygtpwfegsfygitdtsqalrdfarllddpdltartealiareeakvraalepwrarle
    gkrvllytggvkswsvvsalqdlgmkvvatgtkksteedkarirelmgddvkmldegnar
    vllktvdeyqadiliaggrnmytalkgrvpfldinqerefgyagydgmlelvrqlcitle
    cpvweav
    

  • Chain 'H':
    No sequence available.