PDB entry 3pbf

View 3pbf on RCSB PDB site
Description: Surfactant Protein-A neck and carbohydrate recognition domain (NCRD) complexed with glycerol
Class: sugar binding protein
Keywords: collectin, carbohydrate binding, lectin, mannose, SUGAR BINDING PROTEIN
Deposited on 2010-10-20, released 2010-11-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-08-01, with a file datestamp of 2012-07-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pulmonary surfactant-associated protein A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Sftp-1, Sftp1, Sftpa, Sftpa1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08427 (Start-147)
      • engineered mutation (106)
    Domains in SCOPe 2.04: d3pbfa1, d3pbfa2
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3pbfA (A:)
ayldeelqtelyeikhqilqtmgvlslqgsmlsvgdkvfstngqsvnfdtikemctragg
niavprtpeeneaiasiakkynnyvylgmiedqtpgdfhyldgasvsytnwypgeprgqg
kekcvemytdgtwndrgclqyrlavcef

    Sequence, based on observed residues (ATOM records): (download) 
    >3pbfA (A:)
deelqtelyeikhqilqtmgvlslqgsmlsvgdkvfstngqsvnfdtikemctraggnia
vprtpeeneaiasiakkynnyvylgmiedqtpgdfhyldgasvsytnwypgeprgqgkek
cvemytdgtwndrgclqyrlavcef