PDB entry 3pba

View 3pba on RCSB PDB site
Description: Crystal structure of PPARgamma ligand binding domain in complex with monosulfate tetrabromo-bisphenol A (MonoTBBPA)
Class: transcription
Keywords: transcription, ligand binding protein
Deposited on 2010-10-20, released 2011-06-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-08-31, with a file datestamp of 2011-08-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.192
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3pbaa_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3pbab_
  • Heterogens: ZXG, PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3pbaA (A:)
    gshmeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviyd
    mnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldl
    ndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefa
    vkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessql
    fakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pbaA (A:)
    lnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkis
    kevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslm
    nkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviils
    gdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllq
    vikktetdmslhpllqeiykdl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3pbaB (B:)
    gshmeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviyd
    mnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldl
    ndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefa
    vkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessql
    fakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >3pbaB (B:)
    sadlralakhlydsyiksfpltkakarailtgkkspfviydmnslmmgedkfkhkevair
    ifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvl
    isegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgl
    lnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikkte
    hpllqeiyk