PDB entry 3paq

View 3paq on RCSB PDB site
Description: Surfactant Protein A neck and carbohydrate recognition domain (NCRD) complexed with alpha-methylmannose
Class: sugar binding protein
Keywords: collectin, carbohydrate binding, lectin, mannose, sugar binding protein
Deposited on 2010-10-19, released 2010-11-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-03-16, with a file datestamp of 2011-03-11.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.223
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pulmonary surfactant-associated protein A
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Sftpa1, Sftp-1, Sftp1, Sftpa
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08427 (Start-147)
      • engineered mutation (106)
    Domains in SCOPe 2.06: d3paqa1, d3paqa2
  • Heterogens: CA, NA, SO4, MMA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3paqA (A:)
    ayldeelqtelyeikhqilqtmgvlslqgsmlsvgdkvfstngqsvnfdtikemctragg
    niavprtpeeneaiasiakkynnyvylgmiedqtpgdfhyldgasvsytnwypgeprgqg
    kekcvemytdgtwndrgclqyrlavcef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3paqA (A:)
    deelqtelyeikhqilqtmgvlslqgsmlsvgdkvfstngqsvnfdtikemctraggnia
    vprtpeeneaiasiakkynnyvylgmiedqtpgdfhyldgasvsytnwypgeprgqgkek
    cvemytdgtwndrgclqyrlavcef