PDB entry 3pab

View 3pab on RCSB PDB site
Description: Crystal Structure of H2-Kb in complex with a mutant of the chicken ovalbumin epitope OVA-E1
Class: Immune System
Keywords: H2Kb, OVA, APL, altered peptide ligands, ovalbumin, TCR, T cell, Immune System
Deposited on 2010-10-19, released 2011-10-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-11-09, with a file datestamp of 2011-11-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-K1, H2-K
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01901 (1-278)
      • expression tag (0)
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3pabb_
  • Chain 'C':
    Compound: Ovalbumin epitope, EIINFEKL
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01012 (0-7)
      • engineered mutation (0)
  • Chain 'D':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-K1, H2-K
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3pabe_
  • Chain 'F':
    Compound: Ovalbumin epitope, EIINFEKL
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01012 (0-7)
      • engineered mutation (0)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3pabB (B:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3pabE (E:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

  • Chain 'F':
    No sequence available.