PDB entry 3p9m
View 3p9m on RCSB PDB site
Description: Crystal Structure of H2-Kb in complex with a mutant of the chicken ovalbumin epitope OVA-G4
Class: Immune System
Keywords: H2Kb, OVA, APL, altered peptide ligands, ovalbumin, TCR, T cell, Immune System
Deposited on
2010-10-18, released
2011-10-19
The last revision prior to the SCOPe 2.06 freeze date was dated
2013-06-19, with a file datestamp of
2013-06-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.47
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: h-2 class I histocompatibility antigen, k-b alpha chain
Species: Mus musculus [TaxId:10090]
Gene: H2-K1, H2-K
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Beta-2-microglobulin
Species: Mus musculus [TaxId:10090]
Gene: B2M
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3p9mb_ - Chain 'C':
Compound: Ovalbumin epitope, SIIGFEKL
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: h-2 class I histocompatibility antigen, k-b alpha chain
Species: Mus musculus [TaxId:10090]
Gene: H2-K1, H2-K
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: Beta-2-microglobulin
Species: Mus musculus [TaxId:10090]
Gene: B2M
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d3p9me_ - Chain 'F':
Compound: Ovalbumin epitope, SIIGFEKL
Species: synthetic, synthetic
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3p9mB (B:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>3p9mE (E:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
- Chain 'F':
No sequence available.