PDB entry 3p9m

View 3p9m on RCSB PDB site
Description: Crystal Structure of H2-Kb in complex with a mutant of the chicken ovalbumin epitope OVA-G4
Class: Immune System
Keywords: H2Kb, OVA, APL, altered peptide ligands, ovalbumin, TCR, T cell, Immune System
Deposited on 2010-10-18, released 2011-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: h-2 class I histocompatibility antigen, k-b alpha chain
  Species: Mus musculus [TaxId:10090]
  Gene: H2-K1, H2-K
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01901 (0-276)
• Chain 'B':
  Compound: Beta-2-microglobulin
  Species: Mus musculus [TaxId:10090]
  Gene: B2M
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01887 (0-98)
  Domains in SCOPe 2.08: d3p9mb_
• Chain 'C':
  Compound: Ovalbumin epitope, SIIGFEKL
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01012 (0-7)
    • engineered mutation (3)
• Chain 'D':
  Compound: h-2 class I histocompatibility antigen, k-b alpha chain
  Species: Mus musculus [TaxId:10090]
  Gene: H2-K1, H2-K
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01901 (0-276)
• Chain 'E':
  Compound: Beta-2-microglobulin
  Species: Mus musculus [TaxId:10090]
  Gene: B2M
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01887 (0-98)
  Domains in SCOPe 2.08: d3p9me_
• Chain 'F':
  Compound: Ovalbumin epitope, SIIGFEKL
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01012 (0-7)
    • engineered mutation (3)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3p9mB (B:)
  iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
  sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3p9mE (E:)
  iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
  sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
  

  
  
• Chain 'F':
  No sequence available.