PDB entry 3p9k

View 3p9k on RCSB PDB site
Description: Crystal structure of perennial ryegrass LpOMT1 complexed with S-adenosyl-L-homocysteine and coniferaldehyde
Class: transferase
Keywords: S-adenosylmethionine dependent O-methyltransferase, TRANSFERASE
Deposited on 2010-10-17, released 2011-01-12
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.232
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caffeic acid O-methyltransferase
    Species: Lolium perenne [TaxId:4522]
    Gene: LpOMT1, OMT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3p9ka1, d3p9ka2
  • Chain 'B':
    Compound: Caffeic acid O-methyltransferase
    Species: Lolium perenne [TaxId:4522]
    Gene: LpOMT1, OMT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3p9kb1, d3p9kb2
  • Chain 'C':
    Compound: Caffeic acid O-methyltransferase
    Species: Lolium perenne [TaxId:4522]
    Gene: LpOMT1, OMT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3p9kc1, d3p9kc2
  • Chain 'D':
    Compound: Caffeic acid O-methyltransferase
    Species: Lolium perenne [TaxId:4522]
    Gene: LpOMT1, OMT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3p9kd1, d3p9kd2
  • Heterogens: SAH, CIY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p9kA (A:)
    gshgmgstaadmaasadedacmfalqlasssvlpmtlknaielglleilvaaggksltpt
    evaaklpsaanpeapdmvdrilrllasynvvtclveegkdgrlsrsygaapvckfltpne
    dgvsmaalalmnqdkvlmeswyylkdavldggipfnkaygmsafeyhgtdprfnrvfneg
    mknhsiiitkkllelyhgfeglgtlvdvgggvgatvaaiaahyptikgvnfdlphvisea
    pqfpgvthvggdmfkevpsgdtilmkwilhdwsdqhcatllkncydalpahgkvvlvqci
    lpvnpeanpssqgvfhvdmimlahnpggreryerefqalargagftgvkstyiyanawai
    eftk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p9kA (A:)
    taadmaasadedacmfalqlasssvlpmtlknaielglleilvaaggksltptevaaklp
    saanpeapdmvdrilrllasynvvtclveegkdgrlsrsygaapvckfltpnedgvsmaa
    lalmnqdkvlmeswyylkdavldggipfnkaygmsafeyhgtdprfnrvfnegmknhsii
    itkkllelyhgfeglgtlvdvgggvgatvaaiaahyptikgvnfdlphviseapqfpgvt
    hvggdmfkevpsgdtilmkwilhdwsdqhcatllkncydalpahgkvvlvqcilpvnpea
    npssqgvfhvdmimlahnpggreryerefqalargagftgvkstyiyanawaieftk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p9kB (B:)
    gshgmgstaadmaasadedacmfalqlasssvlpmtlknaielglleilvaaggksltpt
    evaaklpsaanpeapdmvdrilrllasynvvtclveegkdgrlsrsygaapvckfltpne
    dgvsmaalalmnqdkvlmeswyylkdavldggipfnkaygmsafeyhgtdprfnrvfneg
    mknhsiiitkkllelyhgfeglgtlvdvgggvgatvaaiaahyptikgvnfdlphvisea
    pqfpgvthvggdmfkevpsgdtilmkwilhdwsdqhcatllkncydalpahgkvvlvqci
    lpvnpeanpssqgvfhvdmimlahnpggreryerefqalargagftgvkstyiyanawai
    eftk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p9kB (B:)
    aadmaasadedacmfalqlasssvlpmtlknaielglleilvaaggksltptevaaklps
    aanpeapdmvdrilrllasynvvtclveegkdgrlsrsygaapvckfltpnedgvsmaal
    almnqdkvlmeswyylkdavldggipfnkaygmsafeyhgtdprfnrvfnegmknhsiii
    tkkllelyhgfeglgtlvdvgggvgatvaaiaahyptikgvnfdlphviseapqfpgvth
    vggdmfkevpsgdtilmkwilhdwsdqhcatllkncydalpahgkvvlvqcilpvnpean
    pssqgvfhvdmimlahnpggreryerefqalargagftgvkstyiyanawaieftk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3p9kC (C:)
    gshgmgstaadmaasadedacmfalqlasssvlpmtlknaielglleilvaaggksltpt
    evaaklpsaanpeapdmvdrilrllasynvvtclveegkdgrlsrsygaapvckfltpne
    dgvsmaalalmnqdkvlmeswyylkdavldggipfnkaygmsafeyhgtdprfnrvfneg
    mknhsiiitkkllelyhgfeglgtlvdvgggvgatvaaiaahyptikgvnfdlphvisea
    pqfpgvthvggdmfkevpsgdtilmkwilhdwsdqhcatllkncydalpahgkvvlvqci
    lpvnpeanpssqgvfhvdmimlahnpggreryerefqalargagftgvkstyiyanawai
    eftk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p9kC (C:)
    taadmaasadedacmfalqlasssvlpmtlknaielglleilvaaggksltptevaaklp
    saanpeapdmvdrilrllasynvvtclveegkdgrlsrsygaapvckfltpnedgvsmaa
    lalmnqdkvlmeswyylkdavldggipfnkaygmsafeyhgtdprfnrvfnegmknhsii
    itkkllelyhgfeglgtlvdvgggvgatvaaiaahyptikgvnfdlphviseapqfpgvt
    hvggdmfkevpsgdtilmkwilhdwsdqhcatllkncydalpahgkvvlvqcilpvnpea
    npssqgvfhvdmimlahnpggreryerefqalargagftgvkstyiyanawaieftk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3p9kD (D:)
    gshgmgstaadmaasadedacmfalqlasssvlpmtlknaielglleilvaaggksltpt
    evaaklpsaanpeapdmvdrilrllasynvvtclveegkdgrlsrsygaapvckfltpne
    dgvsmaalalmnqdkvlmeswyylkdavldggipfnkaygmsafeyhgtdprfnrvfneg
    mknhsiiitkkllelyhgfeglgtlvdvgggvgatvaaiaahyptikgvnfdlphvisea
    pqfpgvthvggdmfkevpsgdtilmkwilhdwsdqhcatllkncydalpahgkvvlvqci
    lpvnpeanpssqgvfhvdmimlahnpggreryerefqalargagftgvkstyiyanawai
    eftk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p9kD (D:)
    asadedacmfalqlasssvlpmtlknaielglleilvaaggksltptevaaklpsaanpe
    apdmvdrilrllasynvvtclveegkdgrlsrsygaapvckfltpnedgvsmaalalmnq
    dkvlmeswyylkdavldggipfnkaygmsafeyhgtdprfnrvfnegmknhsiiitkkll
    elyhgfeglgtlvdvgggvgatvaaiaahyptikgvnfdlphviseapqfpgvthvggdm
    fkevpsgdtilmkwilhdwsdqhcatllkncydalpahgkvvlvqcilpvnpeanpssqg
    vfhvdmimlahnpggreryerefqalargagftgvkstyiyanawaieftk