PDB entry 3p9c

View 3p9c on RCSB PDB site
Description: Crystal structure of perennial ryegrass LpOMT1 bound to SAH
Class: transferase
Keywords: S-adenosylmethionine dependent O-methyltransferase, TRANSFERASE
Deposited on 2010-10-17, released 2011-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-09, with a file datestamp of 2011-02-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.212
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caffeic acid O-methyltransferase
    Species: Lolium perenne [TaxId:4522]
    Gene: LpOMT1, OMT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p9ca1, d3p9ca2
  • Heterogens: SAH, DTV, ACT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p9cA (A:)
    gshgmgstaadmaasadedacmfalqlasssvlpmtlknaielglleilvaaggksltpt
    evaaklpsaanpeapdmvdrilrllasynvvtclveegkdgrlsrsygaapvckfltpne
    dgvsmaalalmnqdkvlmeswyylkdavldggipfnkaygmsafeyhgtdprfnrvfneg
    mknhsiiitkkllelyhgfeglgtlvdvgggvgatvaaiaahyptikgvnfdlphvisea
    pqfpgvthvggdmfkevpsgdtilmkwilhdwsdqhcatllkncydalpahgkvvlvqci
    lpvnpeanpssqgvfhvdmimlahnpggreryerefqalargagftgvkstyiyanawai
    eftk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p9cA (A:)
    aasadedacmfalqlasssvlpmtlknaielglleilvaaggksltptevaaklpsaanp
    eapdmvdrilrllasynvvtclveegkdgrlsrsygaapvckfltpnedgvsmaalalmn
    qdkvlmeswyylkdavldggipfnkaygmsafeyhgtdprfnrvfnegmknhsiiitkkl
    lelyhgfeglgtlvdvgggvgatvaaiaahyptikgvnfdlphviseapqfpgvthvggd
    mfkevpsgdtilmkwilhdwsdqhcatllkncydalpahgkvvlvqcilpvnpeanpssq
    gvfhvdmimlahnpggreryerefqalargagftgvkstyiyanawaieftk