PDB entry 3p98

View 3p98 on RCSB PDB site
Description: The crystal structure of the extended spectrum beta-lactamase TEM-72 reveals inhibition by citrate
Class: hydrolase
Keywords: aba-sandwich, beta-lactamase, HYDROLASE
Deposited on 2010-10-16, released 2011-03-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.208
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase TEM-72
    Species: Morganella morganii [TaxId:582]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p98a_
  • Chain 'B':
    Compound: Beta-lactamase TEM-72
    Species: Morganella morganii [TaxId:582]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p98b_
  • Heterogens: CIT, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p98A (A:)
    msiqhfrvalipffaafclpvfahpetlvkvkdaedklgarvgyieldlnsgkilesfrp
    eerfpmmstfkvllcgavlsrvdagqeqlgrrihysqndlveyspvtekhltdgmtvrel
    csaaitmsdntaanlllttiggpkeltaflhnmgdhvtrldrwepelneaipnderdttt
    paamattlrklltgelltlasrqqlidwmeadkvagpllrsalpagwfiadksgaskrgs
    rgiiaalgpdgkpsrivviyttgsqatmdernrqiaeigaslikhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p98A (A:)
    hpetlvkvkdaedklgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgaskrgsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p98B (B:)
    msiqhfrvalipffaafclpvfahpetlvkvkdaedklgarvgyieldlnsgkilesfrp
    eerfpmmstfkvllcgavlsrvdagqeqlgrrihysqndlveyspvtekhltdgmtvrel
    csaaitmsdntaanlllttiggpkeltaflhnmgdhvtrldrwepelneaipnderdttt
    paamattlrklltgelltlasrqqlidwmeadkvagpllrsalpagwfiadksgaskrgs
    rgiiaalgpdgkpsrivviyttgsqatmdernrqiaeigaslikhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p98B (B:)
    hpetlvkvkdaedklgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgaskrgsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw