PDB entry 3p93

View 3p93 on RCSB PDB site
Description: Crystal structure of D-mannonate dehydratase from Chromohalobacter Salexigens complexed with MG,D-Mannonate and 2-keto-3-deoxy-D-Gluconate
Class: isomerase
Keywords: Enolase fold, multifunctional enzyme, Enolase superfamily, D-Mannonate, D-Gluconate, ISOMERASE
Deposited on 2010-10-15, released 2011-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-10-19, with a file datestamp of 2011-10-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.201
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d3p93a1, d3p93a2, d3p93a3
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d3p93b1, d3p93b2, d3p93b3
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d3p93c1, d3p93c2, d3p93c3
  • Chain 'D':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d3p93d1, d3p93d2, d3p93d3
  • Chain 'E':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d3p93e1, d3p93e2, d3p93e3
  • Chain 'F':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d3p93f1, d3p93f2, d3p93f3
  • Chain 'G':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d3p93g1, d3p93g2, d3p93g3
  • Chain 'H':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d3p93h1, d3p93h2, d3p93h3
  • Heterogens: MG, CS2, KDG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p93A (A:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p93A (A:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgsslpaehvwstekylnhapklfaavr
    erfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttpl
    aigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdls
    pvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideel
    aakypyeraslpvnrledgtlwhw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p93B (B:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p93B (B:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgepadsslpaehvwstekylnhapklf
    aavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlireht
    ttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgp
    tdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdi
    deelaakypyeraslpvnrledgtlwhw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3p93C (C:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p93C (C:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgsslpaehvwstekylnhapklfaavr
    erfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttpl
    aigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdls
    pvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideel
    aakypyeraslpvnrledgtlwhw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3p93D (D:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p93D (D:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgsslpaehvwstekylnhapklfaavr
    erfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttpl
    aigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdls
    pvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideel
    aakypyeraslpvnrledgtlwhw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3p93E (E:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p93E (E:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgepadsslpaehvwstekylnhapklf
    aavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlireht
    ttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgp
    tdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdi
    deelaakypyeraslpvnrledgtlwhw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3p93F (F:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p93F (F:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgslpaehvwstekylnhapklfaavre
    rfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttpla
    igevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdlsp
    vclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideela
    akypyeraslpvnrledgtlwhw
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3p93G (G:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p93G (G:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgslpaehvwstekylnhapklfaavre
    rfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttpla
    igevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdlsp
    vclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideela
    akypyeraslpvnrledgtlwhw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3p93H (H:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p93H (H:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgslpaehvwstekylnhapklfaavre
    rfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttpla
    igevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdlsp
    vclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideela
    akypyeraslpvnrledgtlwhw