PDB entry 3p8i

View 3p8i on RCSB PDB site
Description: Y351F mutant of pentaerythritol tetranitrate reductase containing a bound acetate molecule
Class: oxidoreductase
Keywords: old yellow enzyme family, alpha, beta barrel, OXIDOREDUCTASE
Deposited on 2010-10-14, released 2011-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: 0.13
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pentaerythritol tetranitrate reductase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: onr, PETNR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71278 (Start-364)
      • engineered mutation (351)
    Domains in SCOPe 2.07: d3p8ia_
  • Heterogens: FMN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p8iA (A:)
    msaeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseat
    qisaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqap
    vsasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlve
    lhsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigt
    fqnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviig
    agaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesffgggaegyt
    dypsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p8iA (A:)
    eklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqis
    aqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvsa
    salnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhs
    ahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqn
    vdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigaga
    ytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesffgggaegytdyp
    sl