PDB entry 3p82

View 3p82 on RCSB PDB site
Description: H184N mutant of pentaerythritol tetranitrate reductase containing bound acetate ion
Class: oxidoreductase
Keywords: old yellow enzyme family, alpha, beta barrel, OXIDOREDUCTASE
Deposited on 2010-10-13, released 2011-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.148
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pentaerythritol tetranitrate reductase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: onr, PETNR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71278 (Start-364)
      • engineered mutation (184)
    Domains in SCOPe 2.07: d3p82a_
  • Heterogens: FMN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p82A (A:)
    msaeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseat
    qisaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqap
    vsasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlve
    lhsangyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigt
    fqnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviig
    agaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegyt
    dypsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p82A (A:)
    eklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqis
    aqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvsa
    salnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhs
    angyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqn
    vdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigaga
    ytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdyp
    sl