PDB entry 3p7y

View 3p7y on RCSB PDB site
Description: Pentaerythritol tetranitrate reductase co-crystal structure with bound (E)-1-(2'-hydroxyphenyl)-2-nitroethene
Class: oxidoreductase
Keywords: old yellow enzyme family, alpha, beta barrel, OXIDOREDUCTASE
Deposited on 2010-10-13, released 2011-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pentaerythritol tetranitrate reductase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: onr, PETNR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p7ya_
  • Heterogens: FMN, P7Y, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p7yA (A:)
    msaeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseat
    qisaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqap
    vsasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlve
    lhsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigt
    fqnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviig
    agaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegyt
    dypsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p7yA (A:)
    aeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqi
    saqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvs
    asalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelh
    sahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfq
    nvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigag
    aytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdy
    psl