PDB entry 3p7m

View 3p7m on RCSB PDB site
Description: Structure of putative lactate dehydrogenase from Francisella tularensis subsp. tularensis SCHU S4
Class: oxidoreductase
Keywords: putative dehydrogenase, enzyme, Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, OXIDOREDUCTASE
Deposited on 2010-10-12, released 2010-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.185
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Francisella tularensis [TaxId:119856]
    Gene: FTT_0535c, mdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p7ma1, d3p7ma2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Francisella tularensis [TaxId:119856]
    Gene: FTT_0535c, mdh
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G942 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d3p7mb1, d3p7mb2, d3p7mb3
  • Chain 'C':
    Compound: malate dehydrogenase
    Species: Francisella tularensis [TaxId:119856]
    Gene: FTT_0535c, mdh
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p7mc1, d3p7mc2
  • Chain 'D':
    Compound: malate dehydrogenase
    Species: Francisella tularensis [TaxId:119856]
    Gene: FTT_0535c, mdh
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G942 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d3p7md1, d3p7md2, d3p7md3
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p7mA (A:)
    namarkkitlvgagniggtlahlalikqlgdvvlfdiaqgmpngkaldllqtcpiegvdf
    kvrgtndykdlensdvvivtagvprkpgmsrddllginikvmqtvgegikhncpnafvic
    itnpldimvnmlqkfsgvpdnkivgmagvldsarfrtfladelnvsvqqvqayvmgghgd
    tmvpltkmsnvagvsleqlvkegklkqerldaivsrtrsgggeivallktgsayyapaaa
    giqmaesflkdkkmilpcaakvkagmygldedlfvgvpteisangvrpieveisdkereq
    lqvsinaikdlnkaaaeilak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p7mA (A:)
    markkitlvgagniggtlahlalikqlgdvvlfdiaqgmpngkaldllqtcpiegvdfkv
    rgtndykdlensdvvivtagvprkpgmsrddllginikvmqtvgegikhncpnafvicit
    npldimvnmlqkfsgvpdnkivgmagvldsarfrtfladelnvsvqqvqayvmgghgdtm
    vpltkmsnvagvsleqlvkegklkqerldaivsrtrsgggeivallktgsayyapaaagi
    qmaesflkdkkmilpcaakvkagmygldedlfvgvpteisangvrpieveisdkereqlq
    vsinaikdlnkaaaeila
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p7mB (B:)
    namarkkitlvgagniggtlahlalikqlgdvvlfdiaqgmpngkaldllqtcpiegvdf
    kvrgtndykdlensdvvivtagvprkpgmsrddllginikvmqtvgegikhncpnafvic
    itnpldimvnmlqkfsgvpdnkivgmagvldsarfrtfladelnvsvqqvqayvmgghgd
    tmvpltkmsnvagvsleqlvkegklkqerldaivsrtrsgggeivallktgsayyapaaa
    giqmaesflkdkkmilpcaakvkagmygldedlfvgvpteisangvrpieveisdkereq
    lqvsinaikdlnkaaaeilak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p7mB (B:)
    amarkkitlvgagniggtlahlalikqlgdvvlfdiaqgmpngkaldllqtcpiegvdfk
    vrgtndykdlensdvvivtagvprkpgmsrddllginikvmqtvgegikhncpnafvici
    tnpldimvnmlqkfsgvpdnkivgmagvldsarfrtfladelnvsvqqvqayvmgghgdt
    mvpltkmsnvagvsleqlvkegklkqerldaivsrtrsgggeivallktgsayyapaaag
    iqmaesflkdkkmilpcaakvkagmygldedlfvgvpteisangvrpieveisdkereql
    qvsinaikdlnkaaaeila
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3p7mC (C:)
    namarkkitlvgagniggtlahlalikqlgdvvlfdiaqgmpngkaldllqtcpiegvdf
    kvrgtndykdlensdvvivtagvprkpgmsrddllginikvmqtvgegikhncpnafvic
    itnpldimvnmlqkfsgvpdnkivgmagvldsarfrtfladelnvsvqqvqayvmgghgd
    tmvpltkmsnvagvsleqlvkegklkqerldaivsrtrsgggeivallktgsayyapaaa
    giqmaesflkdkkmilpcaakvkagmygldedlfvgvpteisangvrpieveisdkereq
    lqvsinaikdlnkaaaeilak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p7mC (C:)
    markkitlvgagniggtlahlalikqlgdvvlfdiaqgmpngkaldllqtcpiegvdfkv
    rgtndykdlensdvvivtagvprkpgmsrddllginikvmqtvgegikhncpnafvicit
    npldimvnmlqkfsgvpdnkivgmagvldsarfrtfladelnvsvqqvqayvmgghgdtm
    vpltkmsnvagvsleqlvkegklkqerldaivsrtrsgggeivallktgsayyapaaagi
    qmaesflkdkkmilpcaakvkagmygldedlfvgvpteisangvrpieveisdkereqlq
    vsinaikdlnkaaaeila
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3p7mD (D:)
    namarkkitlvgagniggtlahlalikqlgdvvlfdiaqgmpngkaldllqtcpiegvdf
    kvrgtndykdlensdvvivtagvprkpgmsrddllginikvmqtvgegikhncpnafvic
    itnpldimvnmlqkfsgvpdnkivgmagvldsarfrtfladelnvsvqqvqayvmgghgd
    tmvpltkmsnvagvsleqlvkegklkqerldaivsrtrsgggeivallktgsayyapaaa
    giqmaesflkdkkmilpcaakvkagmygldedlfvgvpteisangvrpieveisdkereq
    lqvsinaikdlnkaaaeilak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p7mD (D:)
    namarkkitlvgagniggtlahlalikqlgdvvlfdiaqgmpngkaldllqtcpiegvdf
    kvrgtndykdlensdvvivtagvprgmsrddllginikvmqtvgegikhncpnafvicit
    npldimvnmlqkfsgvpdnkivgmagvldsarfrtfladelnvsvqqvqayvmgghgdtm
    vpltkmsnvagvsleqlvkegklkqerldaivsrtrsgggeivallktgsayyapaaagi
    qmaesflkdkkmilpcaakvkagmygldedlfvgvpteisangvrpieveisdkereqlq
    vsinaikdlnkaaaeila