PDB entry 3p7g

View 3p7g on RCSB PDB site
Description: Structure of the human Langerin carbohydrate recognition domain in complex with mannose
Class: immune system
Keywords: C-type lectin, membrane protein, glycoprotein, Langerin, DC-SIGN, Carbohydrate binding protein, Calcium binding, sugar binding, Immune system, Langerhans cells, CD207
Deposited on 2010-10-12, released 2010-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K, Leucocyte cDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71 (Start-135)
      • expression tag (136-139)
    Domains in SCOPe 2.07: d3p7ga1, d3p7ga2
  • Chain 'B':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K, Leucocyte cDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p7gb_
  • Chain 'C':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K, Leucocyte cDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UJ71
      • expression tag (138)
    Domains in SCOPe 2.07: d3p7gc1, d3p7gc2
  • Chain 'D':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K, Leucocyte cDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p7gd_
  • Heterogens: CA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p7gA (A:)
    qvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliyw
    igltkagmegdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcd
    ktflfickrpyvpsepsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p7gA (A:)
    gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
    agmegdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcdktflf
    ickrpyvpsepsaws
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p7gB (B:)
    qvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliyw
    igltkagmegdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcd
    ktflfickrpyvpsepsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p7gB (B:)
    sqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigl
    tkagmegdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcdktf
    lfickrpyvp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3p7gC (C:)
    qvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliyw
    igltkagmegdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcd
    ktflfickrpyvpsepsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p7gC (C:)
    gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
    agmegdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcdktflf
    ickrpyvpsw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3p7gD (D:)
    qvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliyw
    igltkagmegdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcd
    ktflfickrpyvpsepsawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p7gD (D:)
    sqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigl
    tkagmegdwswvddtpfnkvqsvrfwipgepnnagnnehcgnikapslqawndapcdktf
    lfickrpyvp