PDB entry 3p6a

View 3p6a on RCSB PDB site
Description: Crystal Structure of the DH/PH domains of p115-RhoGEF (R399E mutant)
Class: signaling protein
Keywords: regulation of RhoA GTPase, RhoGEF, DH, PH, Rho, Signaling Protein
Deposited on 2010-10-11, released 2011-01-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho guanine nucleotide exchange factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHGEF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3p6aa1, d3p6aa2
  • Chain 'B':
    Compound: Rho guanine nucleotide exchange factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHGEF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3p6ab1, d3p6ab2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p6aA (A:)
    giqtsppgweelvppdtlhslpksqvkrqevisellvteaahvrmlrvlhdlffqpmaec
    lffpleelqnifpsldelievhslfldrlmkrrqesgylieeigdvllarfdgaegswfq
    kissrfcsrqsfaleqlkakqrkdprfcafvqeaesrprcrrlqlkdmiptemqrltkyp
    lllqsigqnteepterekvelaaeccreilhhvnqavrdmedllrlkdyqrrldlshlrq
    ssdpmlsefknlditkkklvhegpltwrvtkdkavevhvlllddlllllqrqderlllks
    hsrtltptpdgktmlrpvlrltsamtrevatdhkafyvlftwdqeaqiyelvaqtvserk
    nwcalitetagslkvpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p6aA (A:)
    pksqvkrqevisellvteaahvrmlrvlhdlffqpmaeclffpleelqnifpsldeliev
    hslfldrlmkrrqeslieeigdvllarfdgaegswfqkissrfcsrqsfaleqlkakqrk
    dprfcafvqeaesrprcrrlqlkdmiptemqrltkyplllqsigqnteepterekvelaa
    eccreilhhvnqavrdmedllrlkdyqrrldlshlrqssdpmlsefknlditkkklvheg
    pltwrvtkdkavevhvlllddlllllqrqderlllkshsrtmlrpvlrltsamtrevatd
    hkafyvlftwdqeaqiyelvaqtvserknwcalitetagslkvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p6aB (B:)
    giqtsppgweelvppdtlhslpksqvkrqevisellvteaahvrmlrvlhdlffqpmaec
    lffpleelqnifpsldelievhslfldrlmkrrqesgylieeigdvllarfdgaegswfq
    kissrfcsrqsfaleqlkakqrkdprfcafvqeaesrprcrrlqlkdmiptemqrltkyp
    lllqsigqnteepterekvelaaeccreilhhvnqavrdmedllrlkdyqrrldlshlrq
    ssdpmlsefknlditkkklvhegpltwrvtkdkavevhvlllddlllllqrqderlllks
    hsrtltptpdgktmlrpvlrltsamtrevatdhkafyvlftwdqeaqiyelvaqtvserk
    nwcalitetagslkvpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p6aB (B:)
    pksqvkrqevisellvteaahvrmlrvlhdlffqpmaeclffpleelqnifpsldeliev
    hslfldrlmkrrqeslieeigdvllarfdgaegswfqkissrfcsrqsfaleqlkakqrk
    dprfcafvqeaesrprcrrlqlkdmiptemqrltkyplllqsigqnteepterekvelaa
    eccreilhhvnqavrdmedllrlkdyqrrldlshlrqssdpmlsefknlditkkklvheg
    pltwrvtkdkavevhvlllddlllllqrqderlllkshstmlrpvlrltsamtrevatdh
    kafyvlftwdqeaqiyelvaqtvserknwcalitetagslkvp