PDB entry 3p62

View 3p62 on RCSB PDB site
Description: Wild-type pentaerythritol tetranitrate reductase containing a C-terminal 8-histidine tag
Class: oxidoreductase
Keywords: old yellow enzyme family, alpha,beta barrel, Alkene reduction, OXIDOREDUCTASE
Deposited on 2010-10-11, released 2010-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.127
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pentaerythritol tetranitrate reductase
    Species: Enterobacter cloacae [TaxId:550]
    Gene: onr, PETNR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P71278 (Start-364)
      • expression tag (365-366)
    Domains in SCOPe 2.07: d3p62a1, d3p62a2
  • Heterogens: FMN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p62A (A:)
    msaeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseat
    qisaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqap
    vsasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlve
    lhsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigt
    fqnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviig
    agaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegyt
    dypslhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p62A (A:)
    eklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqis
    aqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvsa
    salnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhs
    ahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqn
    vdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigaga
    ytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdyp
    slhh