PDB entry 3p5t

View 3p5t on RCSB PDB site
Description: CFIm25-CFIm68 complex
Class: RNA binding protein
Keywords: RRM domain, Poly(A) site recognition, RNA, nuclear, RNA BINDING PROTEIN
Deposited on 2010-10-11, released 2010-11-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-11-03, with a file datestamp of 2010-10-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.216
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cleavage and polyadenylation specificity factor subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT21, CFIM25, CPSF25, CPSF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43809 (0-193)
      • expression tag (194-195)
  • Chain 'B':
    Compound: Cleavage and polyadenylation specificity factor subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT21, CFIM25, CPSF25, CPSF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43809 (0-193)
      • expression tag (194-197)
  • Chain 'C':
    Compound: Cleavage and polyadenylation specificity factor subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT21, CFIM25, CPSF25, CPSF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43809 (0-193)
      • expression tag (194-195)
  • Chain 'D':
    Compound: Cleavage and polyadenylation specificity factor subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT21, CFIM25, CPSF25, CPSF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43809 (0-193)
      • expression tag (194-197)
  • Chain 'E':
    Compound: Cleavage and polyadenylation specificity factor subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT21, CFIM25, CPSF25, CPSF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43809 (0-193)
      • expression tag (194)
  • Chain 'F':
    Compound: Cleavage and polyadenylation specificity factor subunit 5
    Species: Homo sapiens [TaxId:9606]
    Gene: NUDT21, CFIM25, CPSF25, CPSF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43809 (0-193)
      • expression tag (194-196)
  • Chain 'L':
    Compound: Cleavage and polyadenylation specificity factor subunit 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CPSF6, CFIM68
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16630
      • engineered mutation (79)
    Domains in SCOPe 2.08: d3p5tl_
  • Chain 'M':
    Compound: Cleavage and polyadenylation specificity factor subunit 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CPSF6, CFIM68
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16630 (Start-81)
      • engineered mutation (79)
    Domains in SCOPe 2.08: d3p5tm_
  • Chain 'N':
    Compound: Cleavage and polyadenylation specificity factor subunit 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CPSF6, CFIM68
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16630 (0-End)
      • engineered mutation (79)
    Domains in SCOPe 2.08: d3p5tn_
  • Chain 'O':
    Compound: Cleavage and polyadenylation specificity factor subunit 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CPSF6, CFIM68
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16630 (0-End)
      • engineered mutation (79)
    Domains in SCOPe 2.08: d3p5to_
  • Chain 'P':
    Compound: Cleavage and polyadenylation specificity factor subunit 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CPSF6, CFIM68
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16630
      • engineered mutation (79)
    Domains in SCOPe 2.08: d3p5tp_
  • Chain 'Q':
    Compound: Cleavage and polyadenylation specificity factor subunit 6
    Species: Homo sapiens [TaxId:9606]
    Gene: CPSF6, CFIM68
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16630 (Start-81)
      • engineered mutation (79)
    Domains in SCOPe 2.08: d3p5tq_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download) 
    >3p5tL (L:)
rialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskk
lmdllpkrelhgqnpvvtpsnklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3p5tL (L:)
lyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvseasskklmdl
lpkrelhgqnpvvtps

  • Chain 'M':
    Sequence, based on SEQRES records: (download) 
    >3p5tM (M:)
rialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskk
lmdllpkrelhgqnpvvtpsnklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3p5tM (M:)
ialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskkl
mdllpkrelhgqnpvvtpsnk

  • Chain 'N':
    Sequence, based on SEQRES records: (download) 
    >3p5tN (N:)
rialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskk
lmdllpkrelhgqnpvvtpsnklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3p5tN (N:)
rialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskk
lmdllpkrelhgqnpvvtps

  • Chain 'O':
    Sequence, based on SEQRES records: (download) 
    >3p5tO (O:)
rialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskk
lmdllpkrelhgqnpvvtpsnklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3p5tO (O:)
rialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskk
lmdllpkrelhgqnpvvtpsn

  • Chain 'P':
    Sequence, based on SEQRES records: (download) 
    >3p5tP (P:)
rialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskk
lmdllpkrelhgqnpvvtpsnklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3p5tP (P:)
ialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskkl
mdllpkrelhgqnpvvtps

  • Chain 'Q':
    Sequence, based on SEQRES records: (download) 
    >3p5tQ (Q:)
rialyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskk
lmdllpkrelhgqnpvvtpsnklehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3p5tQ (Q:)
alyignltwwttdedlteavhslgvndileikffenrangqskgfalvgvgseasskklm
dllpkrelhgqnpvvtpsnk