PDB entry 3p5e

View 3p5e on RCSB PDB site
Description: Structure of the carbohydrate-recognition domain of human Langerin with man4 (Man alpha1-3(Man alpha1-6)Man alpha1-6Man)
Class: sugar binding protein
Keywords: C-type lectin, carbohydrate-binding, SUGAR BINDING PROTEIN
Deposited on 2010-10-08, released 2010-12-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-01-26, with a file datestamp of 2011-01-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.175
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3p5ea_
  • Chain 'B':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3p5eb_
  • Chain 'C':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3p5ec_
  • Chain 'D':
    Compound: C-type lectin domain family 4 member K
    Species: Homo sapiens [TaxId:9606]
    Gene: CD207, CLEC4K
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3p5ed_
  • Heterogens: MAN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p5eA (A:)
    qvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliyw
    igltkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcd
    ktflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p5eA (A:)
    gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
    agmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflf
    ickrpyvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p5eB (B:)
    qvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliyw
    igltkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcd
    ktflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p5eB (B:)
    gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
    agmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflf
    ickrpyvp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3p5eC (C:)
    qvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliyw
    igltkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcd
    ktflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p5eC (C:)
    sqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigl
    tkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktf
    lfickrpyvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3p5eD (D:)
    qvvsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliyw
    igltkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcd
    ktflfickrpyvpsep
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p5eD (D:)
    qgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywiglt
    kagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktfl
    fickrpyv