PDB entry 3p54

View 3p54 on RCSB PDB site
Description: Crystal Structure of the Japanese Encephalitis Virus Envelope Protein, strain SA-14-14-2.
Class: viral protein
Keywords: Viral envelope proteins, structural genomics, fusion peptide, antibody epitopes, Flavivirus, Japanese Encephalitis Virus, Center for Structural Genomics of Infectious Diseases, CSGID, VIRAL PROTEIN
Deposited on 2010-10-07, released 2010-12-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.181
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope glycoprotein
    Species: Japanese encephalitis virus [TaxId:11072]
    Gene: Envelope protein E
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99DQ9 (0-End)
      • conflict (176)
      • conflict (263)
    Domains in SCOPe 2.06: d3p54a1, d3p54a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p54A (A:)
    fnclgmgnrdfiegasgatwvdlvlegdscltimandkptldvrminieasqlaevrsyc
    yhasvtdistvarcpttgeahnekradssyvckqgftdrgwgngcgffgkgsidtcakfs
    ctskaigrtiqpenikykvgifvhgtttsenhgnysaqvgasqaakftvtpnapsvtlkl
    gdygevtldceprsglnteafyvmtvgsksflvhrewfhdlalpwtspsstawrnrellm
    efegahatkqsvvalgsqegglhqalagaivveysssvmltsghlkcrlkmdklalkgtt
    ygmctekfsfaknpvdtghgtvvielsysgsdgpckipivsvaslndmtpvgrlvtvnpf
    vatssanskvlvemeppfgdsyivvgrgdkqinhhwhkagstlgka
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p54A (A:)
    fnclgmgnrdfiegasgatwvdlvlegdscltimandkptldvrminieasqlaevrsyc
    yhasvtdistvarcpttgeahnekradssyvckqgftdrgwgngcgffgkgsidtcakfs
    ctskaigrtiqpenikykvgifvhgtttsenhgnysaqvgasqaakftvtpnapsvtlkl
    gdygevtldceprsglnteafyvmtvgsksflvhrewfhdlalpwtspsstawrnrellm
    efegahatkqsvvalgsqegglhqalagaivveysssvmltsghlkcrlkmdklalkgtt
    ygmctekfsfaknpvdtghgtvvielsysgsdgpckipivsvaslndmtpvgrlvtvnpf
    vatssanskvlvemeppfgdsyivvgrgdkqinhhwhkagstlg