PDB entry 3p4p

View 3p4p on RCSB PDB site
Description: Crystal structure of Menaquinol:fumarate oxidoreductase in complex with fumarate
Class: oxidoreductase
Keywords: Oxidoreductase
Deposited on 2010-10-06, released 2010-12-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.249
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fumarate reductase flavoprotein subunit
    Species: Escherichia coli 042 [TaxId:216592]
    Gene: frdA, EC042_4630
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: fumarate reductase iron-sulfur protein
    Species: Escherichia coli 536 [TaxId:362663]
    Gene: ECP_4399
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3p4pb1, d3p4pb2
  • Chain 'C':
    Compound: Fumarate reductase subunit C
    Species: Escherichia coli DH1 [TaxId:536056]
    Gene: frdC, EcDH1_3838
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3p4pc_
  • Chain 'D':
    Compound: Fumarate reductase subunit D
    Species: Escherichia coli DH1 [TaxId:536056]
    Gene: frdD, EcDH1_3839
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3p4pd_
  • Chain 'M':
    Compound: Fumarate reductase flavoprotein subunit
    Species: Escherichia coli 042 [TaxId:216592]
    Gene: frdA, EC042_4630
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: fumarate reductase iron-sulfur protein
    Species: Escherichia coli 536 [TaxId:362663]
    Gene: ECP_4399
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3p4pn1, d3p4pn2
  • Chain 'O':
    Compound: Fumarate reductase subunit C
    Species: Escherichia coli DH1 [TaxId:536056]
    Gene: frdC, EcDH1_3838
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3p4po_
  • Chain 'P':
    Compound: Fumarate reductase subunit D
    Species: Escherichia coli DH1 [TaxId:536056]
    Gene: frdD, EcDH1_3839
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3p4pp_
  • Heterogens: FAD, FUM, FES, F3S, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3p4pB (B:)
    aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
    icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvdmthfiesleaikpyi
    ignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnpefigpaaitlahryn
    edsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiqqgkvesskdfliatl
    kpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3p4pC (C:)
    ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
    dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
    ivilfvalyw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3p4pD (D:)
    minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq
    sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3p4pN (N:)
    aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
    icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvdmthfiesleaikpyi
    ignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnpefigpaaitlahryn
    edsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiqqgkvesskdfliatl
    kpr
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3p4pO (O:)
    ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
    dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
    ivilfvalyw
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3p4pP (P:)
    minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq
    sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti