PDB entry 3p4k

View 3p4k on RCSB PDB site
Description: The third conformation of p38a MAP kinase observed in phosphorylated p38a and in solution
Class: transferase
Keywords: kinase, phosphorylation, TRANSFERASE
Deposited on 2010-10-06, released 2011-01-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.179
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Mus musculus [TaxId:10090]
    Gene: Mapk14, Crk1, Csbp1, Csbp2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P47811
      • engineered mutation (37)
    Domains in SCOPe 2.07: d3p4ka_
  • Chain 'P':
    Compound: MAP kinase 14
    Species: synthetic, synthetic
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 3P4K (0-10)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p4kA (A:)
    mahhhhhhammsqerptfyrqelnktiwevperyqnlapvgsgaygsvcaafdtktghrv
    avkklsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmg
    adlnnivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfg
    larhtddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhid
    qlklilrlvgtpgaellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlv
    ldsdkritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvp
    ppldqeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p4kA (A:)
    erptfyrqelnktiwevperyqnlapvgsgaygsvcaafdtktghrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglatrwyrapeiml
    nwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesa
    rnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpd
    depvadpydqsfesrdllidewksltydevisfvpppl
    

  • Chain 'P':
    No sequence available.