PDB entry 3p41

View 3p41 on RCSB PDB site
Description: Crystal structure of polyprenyl synthetase from pseudomonas fluorescens pf-5 complexed with magnesium and isoprenyl pyrophosphate
Class: transferase
Keywords: structural genomics, protein structure initiative, new york structural genomix research consortium, nysgxrc, isoprene biosynthesis, transferase, psi-2, new york sgx research center for structural genomics
Deposited on 2010-10-05, released 2010-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranyltranstransferase
    Species: Pseudomonas fluorescens [TaxId:220664]
    Gene: PFL_5509
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4K5A6 (10-End)
      • expression tag (5-9)
    Domains in SCOPe 2.07: d3p41a1, d3p41a2
  • Heterogens: MG, DMA, POP, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p41A (A:)
    mahhhhhhsltayqassqarvdaamhtlftapspelarlyeamrysvmnggkrvrpllay
    aacealggkpeqangaacavelihayslvhddlpamddddlrrgqptthkafdeacaila
    gdglqslafsalldpalsdasaeirlrmvttlaqaagpagmvggqaidlgsvglkldqqa
    leymhrhktgalieasvilgalasgraekgelkalqtyaqaiglafqvqddildvesdta
    tlgkrqgadiardkptypallglaaakeyalelrdqalhalrpfdaaaeplrelaryive
    rrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p41A (A:)
    hhhsltayqassqarvdaamhtlftapspelarlyeamrysvmnggkrvrpllayaacea
    lggkpeqangaacavelihayslvhddlpamddddlrrgqptthkafdeacailagdglq
    slafsalldpalsdasaeirlrmvttlaqaagpagmvggqaidlgsvglkldqqaleymh
    rhktgalieasvilgalasgraekgelkalqtyaqaiglafqvqddildvesdtatptyp
    allglaaakeyalelrdqalhalrpfdaaaeplrelaryiver