PDB entry 3p3n

View 3p3n on RCSB PDB site
Description: Factor inhibiting HIF-1 Alpha in complex with Notch 1 fragment mouse notch (1930-1949) peptide
Class: oxidoreductase/transcription
Keywords: Double Stranded Beta-Helix, hydroxylase, Iron binding, 2-oxoglutarate binding, Hypoxia Inducible Factor binding, Ankyrin Repeat domain binding, OXIDOREDUCTASE-TRANSCRIPTION complex
Deposited on 2010-10-05, released 2010-11-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.204
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypoxia-inducible factor 1-alpha inhibitor
    Species: Homo sapiens [TaxId:9606]
    Gene: FIH1, HIF1AN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p3na_
  • Chain 'B':
    Compound: Notch 1 protein
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: FE2, SO4, AKG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p3nA (A:)
    maataaeavasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelienee
    pvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnr
    eemkfhefveklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwg
    qltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqs
    qvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykga
    ptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p3nA (A:)
    vasgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtn
    lvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhef
    veklqdiqqrggeerlylqqtlndtvgrkivmdflgfnwnwinkqqgkrgwgqltsnlll
    igmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpd
    yerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkriey
    plkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

  • Chain 'B':
    No sequence available.