PDB entry 3p32

View 3p32 on RCSB PDB site
Description: Hydrolysis of GTP to GDP by an MCM-associated and MeaB- and MMAA-like G-protein from Mycobacterium tuberculosis
Class: hydrolase
Keywords: Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, MeaB, MMAA, methylmalonic aciduria protein a, GTPase, G-protein, MCM, methylmalonyl-CoA mutase, incorrectly assigned as an arginine/ornithine transport system ATPase, methylmaolonyl pathway, HYDROLASE
Deposited on 2010-10-04, released 2010-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable GTPase Rv1496/MT1543
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT1543, MTCY277.18, Rv1496
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p32a_
  • Heterogens: GDP, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p32A (A:)
    mahhhhhhmgtleaqtqgpgsmmaashdddtvdglatavrggdraalpraitlvestrpd
    hreqaqqlllrllpdsgnahrvgitgvpgvgkstaiealgmhlierghrvavlavdpsst
    rtggsilgdktrmarlavhpnayirpsptsgtlggvtratretvvlleaagfdvilietv
    gvgqsevavanmvdtfvlltlartgdqlqgikkgvleladivvvnkadgehhkearlaar
    elsaairliyprealwrppvltmsavegrglaelwdtverhrqvltgagefdarrrdqqv
    dwtwqlvrdavldrvwsnptvrkvrselerrvrageltpalaaqqileianltdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p32A (A:)
    tvdglatavrggdraalpraitlvestrpdhreqaqqlllrllpdsgnahrvgitgvpgv
    gkstaiealgmhlierghrvavlavdmarlavhpnayirpspgtlggvtratretvvlle
    aagfdvilietvgvgqsevavanmvdtfvlltlartgdqlqgikkgvleladivvvnkad
    gehhkearlaarelsaairliyprealwrppvltmsavegrglaelwdtverhrqvltga
    gefdarrrdqqvdwtwqlvrdavldrvwsnptvrkvrselerrvrageltpalaaqqile
    ianltd