PDB entry 3p1m

View 3p1m on RCSB PDB site
Description: Crystal structure of human ferredoxin-1 (FDX1) in complex with iron-sulfur cluster
Class: electron transport
Keywords: Structural Genomics Consortium, SGC, ELECTRON TRANSPORT, Adrenodoxin, Ferredoxin, iron-sulfur cluster, Mitochondria
Deposited on 2010-09-30, released 2010-11-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-11-03, with a file datestamp of 2010-10-29.
Experiment type: XRAY
Resolution: 2.54 Å
R-factor: 0.205
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adrenodoxin, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ADX, FDX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10109 (Start-124)
      • expression tag (125-131)
    Domains in SCOPe 2.06: d3p1ma1, d3p1ma2
  • Chain 'B':
    Compound: Adrenodoxin, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ADX, FDX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10109 (Start-124)
      • expression tag (125-131)
    Domains in SCOPe 2.06: d3p1mb1, d3p1mb2
  • Chain 'C':
    Compound: Adrenodoxin, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ADX, FDX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10109 (Start-124)
      • expression tag (125-131)
    Domains in SCOPe 2.06: d3p1mc1, d3p1mc2
  • Chain 'D':
    Compound: Adrenodoxin, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ADX, FDX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10109 (Start-124)
      • expression tag (125-131)
    Domains in SCOPe 2.06: d3p1md1, d3p1md2
  • Chain 'E':
    Compound: Adrenodoxin, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ADX, FDX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10109 (Start-124)
      • expression tag (125-131)
    Domains in SCOPe 2.06: d3p1me1, d3p1me2
  • Chain 'F':
    Compound: Adrenodoxin, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ADX, FDX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10109 (Start-124)
      • expression tag (125-131)
    Domains in SCOPe 2.06: d3p1mf1, d3p1mf2
  • Chain 'G':
    Compound: Adrenodoxin, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ADX, FDX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10109 (Start-124)
      • expression tag (125-131)
    Domains in SCOPe 2.06: d3p1mg1, d3p1mg2
  • Chain 'H':
    Compound: Adrenodoxin, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: ADX, FDX1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10109 (Start-124)
      • expression tag (125-131)
    Domains in SCOPe 2.06: d3p1mh1, d3p1mh2
  • Heterogens: FES, FLC, K, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p1mA (A:)
    msssedkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlif
    edhiyekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsid
    vgktsaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p1mA (A:)
    kitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifedhiye
    kldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvgktsa
    enlyfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p1mB (B:)
    msssedkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlif
    edhiyekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsid
    vgktsaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p1mB (B:)
    kitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifedhiye
    kldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvgktsa
    enlyfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3p1mC (C:)
    msssedkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlif
    edhiyekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsid
    vgktsaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p1mC (C:)
    dkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifedhiy
    ekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvgkts
    aenlyfq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3p1mD (D:)
    msssedkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlif
    edhiyekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsid
    vgktsaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p1mD (D:)
    dkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifedhiy
    ekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvgkts
    aenlyfq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3p1mE (E:)
    msssedkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlif
    edhiyekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsid
    vgktsaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p1mE (E:)
    dkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifedhiy
    ekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvgkts
    aenlyfq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3p1mF (F:)
    msssedkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlif
    edhiyekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsid
    vgktsaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p1mF (F:)
    edkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifedhi
    yekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvgkt
    saenlyfq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3p1mG (G:)
    msssedkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlif
    edhiyekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsid
    vgktsaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p1mG (G:)
    edkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifedhi
    yekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvgkt
    saenlyfq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3p1mH (H:)
    msssedkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlif
    edhiyekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsid
    vgktsaenlyfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p1mH (H:)
    edkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifedhi
    yekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvgkt
    saenlyfq