PDB entry 3p1f

View 3p1f on RCSB PDB site
Description: Crystal structure of the bromodomain of human CREBBP in complex with a hydroquinazolin ligand
Class: transcription
Keywords: Structural Genomics Consortium, SGC, CBP, CREBBP, CREB binding protein isoform a, KAT3A, RSTS, RST, bromodomain, TRANSCRIPTION
Deposited on 2010-09-30, released 2010-12-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.184
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Crebbp
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92793 (2-118)
      • expression tag (0-1)
    Domains in SCOPe 2.03: d3p1fa_
  • Chain 'B':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Crebbp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3p1fb_
  • Heterogens: EDO, K, 3PF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3p1fA (A:)
smrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlsti
krkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3p1fB (B:)
smrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlsti
krkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

    Sequence, based on observed residues (ATOM records): (download) 
    >3p1fB (B:)
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg