PDB entry 3p0w

View 3p0w on RCSB PDB site
Description: Crystal structure of D-Glucarate dehydratase from Ralstonia solanacearum complexed with Mg and D-glucarate
Class: isomerase
Keywords: Structural Genomics, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, PSI2, ISOMERASE
Deposited on 2010-09-29, released 2010-10-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.229
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Ralstonia pickettii [TaxId:402626]
    Gene: Rpic_4449
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p0wa1, d3p0wa2
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Ralstonia pickettii [TaxId:402626]
    Gene: Rpic_4449
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p0wb1, d3p0wb2
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Ralstonia pickettii [TaxId:402626]
    Gene: Rpic_4449
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p0wc1, d3p0wc2
  • Chain 'D':
    Compound: Mandelate racemase/muconate lactonizing protein
    Species: Ralstonia pickettii [TaxId:402626]
    Gene: Rpic_4449
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3p0wd1, d3p0wd2
  • Heterogens: MG, GKR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p0wA (A:)
    mslrthtprvtemqvipvagrdsmllnlcgahapfftrnlvilkdnagrtgvgevpggeg
    irqalerviplvvgqsigrtngvlssirralagggnaahqatvhqvtsaseaavlrqphe
    inlrmdnvitaveaalldllgqflevpvaellgagqqrdsapmlaylfyvgdrrktdlpy
    legangaddwlrlrheaamtpaaiarlaeaaterygfadfklkggvmpgaeemeaiaaik
    arfpharvtldpngawslneaialckgqghlvayaedpcgpeagysgrevmaefkratgi
    ptatnmiatdwrqmghavqlhavdipladphfwtmqgsvrvaqlcdewgltwgshsnnhf
    dvslamfthvaaaapgnitaidthwiwqeaqerltreplriqgghvavperpglgieidm
    drvmaahalyktlgpgarddamamqylvpgwtydpkrpslrreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0wA (A:)
    htprvtemqvipvagrdsmllnlcgahapfftrnlvilkdnagrtgvgevpggegirqal
    erviplvvgqsigrtngvlssirralarmdnvitaveaalldllgqflevpvaellgagq
    qrdsapmlaylfyvgdrrktdlpylegangaddwlrlrheaamtpaaiarlaeaateryg
    fadfklkggvmpgaeemeaiaaikarfpharvtldpngawslneaialckgqghlvayae
    dpcgpeagysgrevmaefkratgiptatnmiatdwrqmghavqlhavdipladphfwtmq
    gsvrvaqlcdewgltwgshsnnhfdvslamfthvaaaapgnitaidthwiwqeaqerltr
    eplriqgghvavperpglgieidmdrvmaahalyktlgpgarddamamqylvpgwtydpk
    rpsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p0wB (B:)
    mslrthtprvtemqvipvagrdsmllnlcgahapfftrnlvilkdnagrtgvgevpggeg
    irqalerviplvvgqsigrtngvlssirralagggnaahqatvhqvtsaseaavlrqphe
    inlrmdnvitaveaalldllgqflevpvaellgagqqrdsapmlaylfyvgdrrktdlpy
    legangaddwlrlrheaamtpaaiarlaeaaterygfadfklkggvmpgaeemeaiaaik
    arfpharvtldpngawslneaialckgqghlvayaedpcgpeagysgrevmaefkratgi
    ptatnmiatdwrqmghavqlhavdipladphfwtmqgsvrvaqlcdewgltwgshsnnhf
    dvslamfthvaaaapgnitaidthwiwqeaqerltreplriqgghvavperpglgieidm
    drvmaahalyktlgpgarddamamqylvpgwtydpkrpslrreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0wB (B:)
    htprvtemqvipvagrdsmllnlcgahapfftrnlvilkdnagrtgvgevpggegirqal
    erviplvvgqsigrtngvlssirralaeinlrmdnvitaveaalldllgqflevpvaell
    gagqqrdsapmlaylfyvgdrrktdlpylegangaddwlrlrheaamtpaaiarlaeaat
    erygfadfklkggvmpgaeemeaiaaikarfpharvtldpngawslneaialckgqghlv
    ayaedpcgpeagysgrevmaefkratgiptatnmiatdwrqmghavqlhavdipladphf
    wtmqgsvrvaqlcdewgltwgshsnnhfdvslamfthvaaaapgnitaidthwiwqeaqe
    rltreplriqgghvavperpglgieidmdrvmaahalyktlgpgarddamamqylvpgwt
    ydpkrpsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3p0wC (C:)
    mslrthtprvtemqvipvagrdsmllnlcgahapfftrnlvilkdnagrtgvgevpggeg
    irqalerviplvvgqsigrtngvlssirralagggnaahqatvhqvtsaseaavlrqphe
    inlrmdnvitaveaalldllgqflevpvaellgagqqrdsapmlaylfyvgdrrktdlpy
    legangaddwlrlrheaamtpaaiarlaeaaterygfadfklkggvmpgaeemeaiaaik
    arfpharvtldpngawslneaialckgqghlvayaedpcgpeagysgrevmaefkratgi
    ptatnmiatdwrqmghavqlhavdipladphfwtmqgsvrvaqlcdewgltwgshsnnhf
    dvslamfthvaaaapgnitaidthwiwqeaqerltreplriqgghvavperpglgieidm
    drvmaahalyktlgpgarddamamqylvpgwtydpkrpslrreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0wC (C:)
    htprvtemqvipvagrdsmllnlcgahapfftrnlvilkdnagrtgvgevpggegirqal
    erviplvvgqsigrtngvlssirralarmdnvitaveaalldllgqflevpvaellgagq
    qrdsapmlaylfyvgdrrktdlpylegaddwlrlrheaamtpaaiarlaeaaterygfad
    fklkggvmpgaeemeaiaaikarfpharvtldpngawslneaialckgqghlvayaedpc
    gpeagysgrevmaefkratgiptatnmiatdwrqmghavqlhavdipladphfwtmqgsv
    rvaqlcdewgltwgshsnnhfdvslamfthvaaaapgnitaidthwiwqeaqerltrepl
    riqgghvavperpglgieidmdrvmaahalyktlgpgarddamamqylvpgwtydpkrps
    l
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3p0wD (D:)
    mslrthtprvtemqvipvagrdsmllnlcgahapfftrnlvilkdnagrtgvgevpggeg
    irqalerviplvvgqsigrtngvlssirralagggnaahqatvhqvtsaseaavlrqphe
    inlrmdnvitaveaalldllgqflevpvaellgagqqrdsapmlaylfyvgdrrktdlpy
    legangaddwlrlrheaamtpaaiarlaeaaterygfadfklkggvmpgaeemeaiaaik
    arfpharvtldpngawslneaialckgqghlvayaedpcgpeagysgrevmaefkratgi
    ptatnmiatdwrqmghavqlhavdipladphfwtmqgsvrvaqlcdewgltwgshsnnhf
    dvslamfthvaaaapgnitaidthwiwqeaqerltreplriqgghvavperpglgieidm
    drvmaahalyktlgpgarddamamqylvpgwtydpkrpslrreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0wD (D:)
    thtprvtemqvipvagrdsmllnlcgahapfftrnlvilkdnagrtgvgevpggegirqa
    lerviplvvgqsigrtngvlssirralarmdnvitaveaalldllgqflevpvaellgag
    qqrdsapmlaylfyvgdrrktdlpylegangaddwlrlrheaamtpaaiarlaeaatery
    gfadfklkggvmpgaeemeaiaaikarfpharvtldpngawslneaialckgqghlvaya
    edpcgpeagysgrevmaefkratgiptatnmiatdwrqmghavqlhavdipladphfwtm
    qgsvrvaqlcdewgltwgshsnnhfdvslamfthvaaaapgnitaidthwiwqeaqerlt
    replriqgghvavperpglgieidmdrvmaahalyktlgpgarddamamqylvpgwtydp
    krpsl