PDB entry 3p0e

View 3p0e on RCSB PDB site
Description: Structure of hUPP2 in an active conformation with bound 5-benzylacyclouridine
Class: transferase
Keywords: uridine phosphorylase, TRANSFERASE
Deposited on 2010-09-28, released 2011-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uridine phosphorylase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UPP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p0ea_
  • Chain 'B':
    Compound: uridine phosphorylase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UPP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p0eb_
  • Chain 'C':
    Compound: uridine phosphorylase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UPP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p0ec_
  • Chain 'D':
    Compound: uridine phosphorylase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UPP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p0ed_
  • Chain 'E':
    Compound: uridine phosphorylase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UPP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p0ee_
  • Chain 'F':
    Compound: uridine phosphorylase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UPP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3p0ef_
  • Heterogens: BAU, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3p0eA (A:)
    gssgkrfvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalf
    mhkelgfeeaeedikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharc
    cdvtiirigtsggigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelf
    ncskeipnfptlvghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemes
    tvfaamcglcglkaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0eA (A:)
    fvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalfmhkelg
    fikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharccdvtiirigtsg
    gigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelfncskeipnfptl
    vghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemestvfaamcglcgl
    kaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3p0eB (B:)
    gssgkrfvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalf
    mhkelgfeeaeedikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharc
    cdvtiirigtsggigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelf
    ncskeipnfptlvghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemes
    tvfaamcglcglkaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0eB (B:)
    fvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalfmhkelg
    fikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharccdvtiirigtsg
    gigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelfncskeipnfptl
    vghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemestvfaamcglcgl
    kaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3p0eC (C:)
    gssgkrfvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalf
    mhkelgfeeaeedikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharc
    cdvtiirigtsggigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelf
    ncskeipnfptlvghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemes
    tvfaamcglcglkaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0eC (C:)
    fvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalfmhkelg
    feeaeedikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharccdvtii
    rigtsggigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelfncskei
    pnfptlvghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemestvfaam
    cglcglkaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3p0eD (D:)
    gssgkrfvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalf
    mhkelgfeeaeedikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharc
    cdvtiirigtsggigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelf
    ncskeipnfptlvghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemes
    tvfaamcglcglkaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0eD (D:)
    fvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalfmhkelg
    fikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharccdvtiirigtsg
    gigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelfncskeipnfptl
    vghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemestvfaamcglcgl
    kaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3p0eE (E:)
    gssgkrfvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalf
    mhkelgfeeaeedikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharc
    cdvtiirigtsggigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelf
    ncskeipnfptlvghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemes
    tvfaamcglcglkaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0eE (E:)
    fvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalfmhkelg
    feeaeedikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharccdvtii
    rigtsggigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelfncskei
    pnfptlvghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemestvfaam
    cglcglkaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3p0eF (F:)
    gssgkrfvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalf
    mhkelgfeeaeedikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharc
    cdvtiirigtsggigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelf
    ncskeipnfptlvghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemes
    tvfaamcglcglkaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3p0eF (F:)
    fvhvknpyldlmdedilyhldlgtkthnlpamfgdvkfvcvggspnrmkafalfmhkelg
    fikdicagtdrycmyktgpvlaishgmgipsisimlhelikllhharccdvtiirigtsg
    gigiapgtvvitdiavdsffkprfeqvildnivtrsteldkelseelfncskeipnfptl
    vghtmctydfyegqgrldgalcsfsrekkldylkrafkagvrniemestvfaamcglcgl
    kaavvcvtlldrldcdqinlphdvlveyqqrpqllisnfirrrlg