PDB entry 3ozy

View 3ozy on RCSB PDB site
Description: Crystal structure of enolase superfamily member from Bordetella bronchiseptica complexed with Mg and m-Xylarate
Class: unknown function
Keywords: beta-alpha barrel, ENOLASE superfamily member, m-Xylarate, UNKNOWN FUNCTION
Deposited on 2010-09-27, released 2011-09-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.155
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative mandelate racemase
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BB4687
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WEE8
      • expression tag (1-2)
    Domains in SCOPe 2.06: d3ozya1, d3ozya2, d3ozya3
  • Chain 'B':
    Compound: Putative mandelate racemase
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BB4687
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WEE8
      • expression tag (1-2)
    Domains in SCOPe 2.06: d3ozyb1, d3ozyb2, d3ozyb3
  • Heterogens: MG, GOL, ACY, DXL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ozyA (A:)
    mslkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlav
    lkraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgr
    amnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprk
    daanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghri
    lraqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahla
    wnphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpg
    lgfeidwdfvaahawkgepaigaghgmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ozyA (A:)
    slkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavl
    kraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgra
    mnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkd
    aanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghril
    raqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahlaw
    nphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpgl
    gfeidwdfvaahawkgepaigaghgm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ozyB (B:)
    mslkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlav
    lkraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgr
    amnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprk
    daanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghri
    lraqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahla
    wnphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpg
    lgfeidwdfvaahawkgepaigaghgmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ozyB (B:)
    slkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavl
    kraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgra
    mnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkd
    aanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghril
    raqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahlaw
    nphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpgl
    gfeidwdfvaahawkgepaigaghgm