PDB entry 3ozm

View 3ozm on RCSB PDB site
Description: Crystal structure of enolase superfamily member from Bordetella bronchiseptica complexed with Mg, m-Xylarate and L-Lyxarate
Class: transferase
Keywords: alpha-beta Barrel, enolase superfamily member, function unknown, slow substrate m-Xylarate, m-Xylarate Binding, TRANSFERASE
Deposited on 2010-09-25, released 2011-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.193
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative mandelate racemase
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BB4687
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WEE8
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3ozma1, d3ozma2, d3ozma3
  • Chain 'B':
    Compound: Putative mandelate racemase
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BB4687
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WEE8
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3ozmb1, d3ozmb2, d3ozmb3
  • Chain 'C':
    Compound: Putative mandelate racemase
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BB4687
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WEE8
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3ozmc1, d3ozmc2, d3ozmc3
  • Chain 'D':
    Compound: Putative mandelate racemase
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BB4687
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WEE8
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3ozmd1, d3ozmd2, d3ozmd3
  • Chain 'E':
    Compound: Putative mandelate racemase
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BB4687
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WEE8
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3ozme1, d3ozme2, d3ozme3
  • Chain 'F':
    Compound: Putative mandelate racemase
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BB4687
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WEE8
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3ozmf1, d3ozmf2, d3ozmf3
  • Chain 'G':
    Compound: Putative mandelate racemase
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BB4687
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WEE8
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3ozmg1, d3ozmg2, d3ozmg3
  • Chain 'H':
    Compound: Putative mandelate racemase
    Species: Bordetella bronchiseptica [TaxId:518]
    Gene: BB4687
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WEE8
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3ozmh1, d3ozmh2, d3ozmh3
  • Heterogens: MG, DXL, GOL, LY9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ozmA (A:)
    mslkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlav
    lkraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgr
    amnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprk
    daanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghri
    lraqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahla
    wnphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpg
    lgfeidwdfvaahawkgepaigaghgmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ozmA (A:)
    slkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavl
    kraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgra
    mnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkd
    aanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghril
    raqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahlaw
    nphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpgl
    gfeidwdfvaahawkgepaigaghgm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ozmB (B:)
    mslkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlav
    lkraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgr
    amnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprk
    daanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghri
    lraqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahla
    wnphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpg
    lgfeidwdfvaahawkgepaigaghgmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ozmB (B:)
    slkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavl
    kraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgra
    mnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkd
    aanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghril
    raqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahlaw
    nphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpgl
    gfeidwdfvaahawkgepaigaghgm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ozmC (C:)
    mslkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlav
    lkraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgr
    amnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprk
    daanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghri
    lraqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahla
    wnphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpg
    lgfeidwdfvaahawkgepaigaghgmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ozmC (C:)
    slkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavl
    kraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgra
    mnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkd
    aanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghril
    raqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahlaw
    nphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpgl
    gfeidwdfvaahawkgepaigaghgm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ozmD (D:)
    mslkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlav
    lkraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgr
    amnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprk
    daanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghri
    lraqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahla
    wnphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpg
    lgfeidwdfvaahawkgepaigaghgmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ozmD (D:)
    slkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavl
    kraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgra
    mnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkd
    aanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghril
    raqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahlaw
    nphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpgl
    gfeidwdfvaahawkgepaig
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ozmE (E:)
    mslkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlav
    lkraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgr
    amnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprk
    daanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghri
    lraqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahla
    wnphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpg
    lgfeidwdfvaahawkgepaigaghgmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ozmE (E:)
    slkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavl
    kraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgra
    mnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkd
    aanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghril
    raqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahlaw
    nphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpgl
    gfeidwdfvaahawkgepaigaghgm
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ozmF (F:)
    mslkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlav
    lkraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgr
    amnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprk
    daanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghri
    lraqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahla
    wnphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpg
    lgfeidwdfvaahawkgepaigaghgmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ozmF (F:)
    slkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavl
    kraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgra
    mnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkd
    aanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghril
    raqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahlaw
    nphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpgl
    gfeidwdfvaahawkgepaigaghgm
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ozmG (G:)
    mslkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlav
    lkraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgr
    amnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprk
    daanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghri
    lraqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahla
    wnphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpg
    lgfeidwdfvaahawkgepaigaghgmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ozmG (G:)
    slkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavl
    kraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgra
    mnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkd
    aanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghril
    raqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahlaw
    nphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpgl
    gfeidwdfvaahawkgepaigaghgm
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ozmH (H:)
    mslkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlav
    lkraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgr
    amnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprk
    daanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghri
    lraqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahla
    wnphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpg
    lgfeidwdfvaahawkgepaigaghgmkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ozmH (H:)
    slkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavl
    kraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgra
    mnqpiyqllggkfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkd
    aanlramrqrvgadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghril
    raqgtpvriatgenlytrnafndyirndaidvlqadasraggitealaisasaasahlaw
    nphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpgl
    gfeidwdfvaahawkgepai