PDB entry 3oz9

View 3oz9 on RCSB PDB site
Description: Crystal Structure of anti-gp41 Fab NC-1
Class: immune system
Keywords: immunoglobulin fold, non-neutralizing antibody, HIV-1 gp41 6-helix bundle core, IMMUNE SYSTEM
Deposited on 2010-09-24, released 2010-10-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-06, with a file datestamp of 2010-10-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.192
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Fab NC-1 IgG2a heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OZ9 (0-118)
    • Uniprot Q569W9 (119-218)
  • Chain 'L':
    Compound: Fab NC-1 kappa light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3OZ9 (0-104)
    • Uniprot Q5XFY8 (105-210)
    Domains in SCOPe 2.06: d3oz9l1, d3oz9l2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3oz9L (L:)
    qivltqspvimsaslgeeitltcsasssvsymhwyqqksgtspklliystsnlasgvpsr
    fsgsgsgtfysltissveaedaadyychqwsgfytfgggtkleiqradaaptvsifppss
    eqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltlt
    kdeyerhnsytceathktstspivksfnrne