PDB entry 3oz0

View 3oz0 on RCSB PDB site
Description: PPAR Delta in complex with azppard02
Class: transcription/transcription regulator
Keywords: TRANSCRIPTION FACTOR, TRANSCRIPTION, NUCLEAR RECEPTOR FOLD, TRANSCRIPTION REGULATION, TRANSCRIPTION-TRANSCRIPTION REGULATOR complex
Deposited on 2010-09-24, released 2011-01-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-29, with a file datestamp of 2012-02-24.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.22
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor delta
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARD, NR1C2, PPARB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3oz0a_
  • Heterogens: 3OZ

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3oz0A (A:)
    mghhhhhhgsqynpqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdi
    etlwqaekglvwkqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslfln
    dqvtllkygvheaifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefav
    kfnalelddsdlalfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylf
    pkllqkmadlrqlvtehaqmmqrikktetetslhpllqeiykdmy
    

    Sequence, based on observed residues (ATOM records): (download)
    >3oz0A (A:)
    lkafskhiynaylknfnmtkkkarsiltapfvihdietlwqaekglvwkqlvnglppyke
    isvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivnk
    dgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcgd
    rpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlvtehaqmmqri
    kktetetslhpllqeiykdm