PDB entry 3ow6

View 3ow6 on RCSB PDB site
Description: Crystal Structure of HSP90 with N-Aryl-benzimidazolone I
Class: chaperone
Keywords: hsp90, chaperone
Deposited on 2010-09-17, released 2011-09-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07900 (0-206)
      • conflict (46)
    Domains in SCOPe 2.06: d3ow6a_
  • Heterogens: MEX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3ow6A (A:)
vetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryetltdpskldsgkel
hinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfgv
gfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqte
yleerrikeivkkhsqfigypitlfve