PDB entry 3ow1

View 3ow1 on RCSB PDB site
Description: Crystal structure of D-mannonate dehydratase from Chromohalobacter salexigens complexed with MG
Class: lyase
Keywords: d-mannonate dehydratase, lyase
Deposited on 2010-09-17, released 2011-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.163
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d3ow1a1, d3ow1a2, d3ow1a3
  • Chain 'B':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d3ow1b1, d3ow1b2, d3ow1b3
  • Chain 'C':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d3ow1c1, d3ow1c2, d3ow1c3
  • Chain 'D':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d3ow1d1, d3ow1d2, d3ow1d3
  • Chain 'E':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3ow1e1, d3ow1e2, d3ow1e3
  • Chain 'F':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d3ow1f1, d3ow1f2, d3ow1f3
  • Chain 'G':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d3ow1g1, d3ow1g2, d3ow1g3
  • Chain 'H':
    Compound: Mandelate racemase/muconate lactonizing enzyme
    Species: Chromohalobacter salexigens [TaxId:158080]
    Gene: Csal_2974
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1QT89 (3-404)
      • expression tag (2)
    Domains in SCOPe 2.07: d3ow1h1, d3ow1h2, d3ow1h3
  • Heterogens: MG, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ow1A (A:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ow1A (A:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgsslpaehvwstekylnhapklfaavr
    erfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttpl
    aigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdls
    pvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideel
    aakypyeraslpvnrledgtlwhw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ow1B (B:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ow1B (B:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgepadsslpaehvwstekylnhapklf
    aavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlireht
    ttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgp
    tdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdi
    deelaakypyeraslpvnrledgtlwhw
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ow1C (C:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ow1C (C:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgpadsslpaehvwstekylnhapklfa
    avrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtt
    tplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgpt
    dlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdid
    eelaakypyeraslpvnrledgtlwhw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ow1D (D:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ow1D (D:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgpadsslpaehvwstekylnhapklfa
    avrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtt
    tplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgpt
    dlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdid
    eelaakypyeraslpvnrledgtlwhw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ow1E (E:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ow1E (E:)
    slkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrd
    agriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmt
    yahctgqtiedclgevarhvelgyravrvqsgvpgepadsslpaehvwstekylnhapkl
    faavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlireh
    tttplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhg
    ptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvd
    ideelaakypyeraslpvnrledgtlwhw
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ow1F (F:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ow1F (F:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgpadsslpaehvwstekylnhapklfa
    avrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtt
    tplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgpt
    dlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdid
    eelaakypyeraslpvnrledgtlwhw
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ow1G (G:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ow1G (G:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgslpaehvwstekylnhapklfaavre
    rfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtttpla
    igevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgptdlsp
    vclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdideela
    akypyeraslpvnrledgtlwhw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ow1H (H:)
    mslkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligr
    dagriedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervm
    tyahctgqtiedclgevarhvelgyravrvqsgvpgiettygvaktpgeryepadsslpa
    ehvwstekylnhapklfaavrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwled
    cvpaenqeslrlirehtttplaigevfnsihdcreliqnqwidyirmplthgggitamrr
    vadlaslyhvrtgfhgptdlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrf
    edghflagespghgvdideelaakypyeraslpvnrledgtlwhw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ow1H (H:)
    lkirdaytivtcpgrnfvtlkivtesgthgigdatlngremavaayldehvvpaligrda
    griedtwqylyrgaywrrgpvtmtaiaavdmalwdikakaagmplyqllggksrervmty
    ahctgqtiedclgevarhvelgyravrvqsgvpgpadsslpaehvwstekylnhapklfa
    avrerfgddlhvlhdvhhrltpieaarlgkavepyhlfwledcvpaenqeslrlirehtt
    tplaigevfnsihdcreliqnqwidyirmplthgggitamrrvadlaslyhvrtgfhgpt
    dlspvclgaaihfdtwvpnfgiqehmphtdetdavfphdyrfedghflagespghgvdid
    eelaakypyeraslpvnrledgtlwhw