PDB entry 3ov3

View 3ov3 on RCSB PDB site
Description: G211F mutant of curcumin synthase 1 from Curcuma longa
Class: transferase
Keywords: type III polyketide synthase, TRANSFERASE
Deposited on 2010-09-15, released 2010-12-08
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.195
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Curcumin synthase
    Species: Curcuma longa [TaxId:136217]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0SVZ6 (Start-388)
      • engineered mutation (210)
      • expression tag (389-390)
    Domains in SCOPe 2.05: d3ov3a1, d3ov3a2
  • Chain 'B':
    Compound: Curcumin synthase
    Species: Curcuma longa [TaxId:136217]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0SVZ6 (Start-388)
      • engineered mutation (210)
      • expression tag (389-390)
    Domains in SCOPe 2.05: d3ov3b1, d3ov3b2
  • Chain 'C':
    Compound: Curcumin synthase
    Species: Curcuma longa [TaxId:136217]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0SVZ6 (Start-388)
      • engineered mutation (210)
      • expression tag (389-392)
    Domains in SCOPe 2.05: d3ov3c1, d3ov3c2
  • Chain 'D':
    Compound: Curcumin synthase
    Species: Curcuma longa [TaxId:136217]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0SVZ6 (Start-388)
      • engineered mutation (210)
      • expression tag (389-390)
    Domains in SCOPe 2.05: d3ov3d1, d3ov3d2
  • Heterogens: MLI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ov3A (A:)
    manlhalrreqraqgpatimaigtatppnlyeqstfpdfyfrvtnsddkqelkkkfrrmc
    ektmvkkrylhlteeilkerpklcsykeasfddrqdivveeiprlakeaaekaikewgrp
    kseithlvfcsisgidmpgadyrlatllglpltvnrlmiysqachmgaamlriakdlaen
    nrgarvlvvaceitvlsfrgpnegdfealafqagfgdgagavvvgadplegiekpiyeia
    aamqetvaesqgavgghlrafgwtfyflnqlpaiiadnlgrsleralaplgvrewndvfw
    vahpgnwaiidaieaklqlspdklstarhvfteygnmqsatvyfvmdelrkrsavegrst
    tgdglqwgvllgfgpglsietvvlrsmplhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ov3A (A:)
    halrreqraqgpatimaigtatppnlyeqstfpdfyfrvtnsddkqelkkkfrrmcektm
    vkkrylhlteeilkerpklcsykeasfddrqdivveeiprlakeaaekaikewgrpksei
    thlvfcsisgidmpgadyrlatllglpltvnrlmiysqachmgaamlriakdlaennrga
    rvlvvaceitvlsfrgpnegdfealafqagfgdgagavvvgadplegiekpiyeiaaamq
    etvaesqgavgghlrafgwtfyflnqlpaiiadnlgrsleralaplgvrewndvfwvahp
    gnwaiidaieaklqlspdklstarhvfteygnmqsatvyfvmdelrkrsavegrsttgdg
    lqwgvllgfgpglsietvvlrsmplhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ov3B (B:)
    manlhalrreqraqgpatimaigtatppnlyeqstfpdfyfrvtnsddkqelkkkfrrmc
    ektmvkkrylhlteeilkerpklcsykeasfddrqdivveeiprlakeaaekaikewgrp
    kseithlvfcsisgidmpgadyrlatllglpltvnrlmiysqachmgaamlriakdlaen
    nrgarvlvvaceitvlsfrgpnegdfealafqagfgdgagavvvgadplegiekpiyeia
    aamqetvaesqgavgghlrafgwtfyflnqlpaiiadnlgrsleralaplgvrewndvfw
    vahpgnwaiidaieaklqlspdklstarhvfteygnmqsatvyfvmdelrkrsavegrst
    tgdglqwgvllgfgpglsietvvlrsmplhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ov3B (B:)
    nlhalrreqraqgpatimaigtatppnlyeqstfpdfyfrvtnsddkqelkkkfrrmcek
    tmvkkrylhlteeilkerpklcsykeasfddrqdivveeiprlakeaaekaikewgrpks
    eithlvfcsisgidmpgadyrlatllglpltvnrlmiysqachmgaamlriakdlaennr
    garvlvvaceitvlsfrgpnegdfealafqagfgdgagavvvgadplegiekpiyeiaaa
    mqetvaesqgavgghlrafgwtfyflnqlpaiiadnlgrsleralaplgvrewndvfwva
    hpgnwaiidaieaklqlspdklstarhvfteygnmqsatvyfvmdelrkrsavegrsttg
    dglqwgvllgfgpglsietvvlrsmplhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ov3C (C:)
    manlhalrreqraqgpatimaigtatppnlyeqstfpdfyfrvtnsddkqelkkkfrrmc
    ektmvkkrylhlteeilkerpklcsykeasfddrqdivveeiprlakeaaekaikewgrp
    kseithlvfcsisgidmpgadyrlatllglpltvnrlmiysqachmgaamlriakdlaen
    nrgarvlvvaceitvlsfrgpnegdfealafqagfgdgagavvvgadplegiekpiyeia
    aamqetvaesqgavgghlrafgwtfyflnqlpaiiadnlgrsleralaplgvrewndvfw
    vahpgnwaiidaieaklqlspdklstarhvfteygnmqsatvyfvmdelrkrsavegrst
    tgdglqwgvllgfgpglsietvvlrsmplhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ov3C (C:)
    nlhalrreqraqgpatimaigtatppnlyeqstfpdfyfrvtnsddkqelkkkfrrmcek
    tmvkkrylhlteeilkerpklcsykeasfddrqdivveeiprlakeaaekaikewgrpks
    eithlvfcsisgidmpgadyrlatllglpltvnrlmiysqachmgaamlriakdlaennr
    garvlvvaceitvlsfrgpnegdfealafqagfgdgagavvvgadplegiekpiyeiaaa
    mqetvaesqgavgghlrafgwtfyflnqlpaiiadnlgrsleralaplgvrewndvfwva
    hpgnwaiidaieaklqlspdklstarhvfteygnmqsatvyfvmdelrkrsavegrsttg
    dglqwgvllgfgpglsietvvlrsmplhhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ov3D (D:)
    manlhalrreqraqgpatimaigtatppnlyeqstfpdfyfrvtnsddkqelkkkfrrmc
    ektmvkkrylhlteeilkerpklcsykeasfddrqdivveeiprlakeaaekaikewgrp
    kseithlvfcsisgidmpgadyrlatllglpltvnrlmiysqachmgaamlriakdlaen
    nrgarvlvvaceitvlsfrgpnegdfealafqagfgdgagavvvgadplegiekpiyeia
    aamqetvaesqgavgghlrafgwtfyflnqlpaiiadnlgrsleralaplgvrewndvfw
    vahpgnwaiidaieaklqlspdklstarhvfteygnmqsatvyfvmdelrkrsavegrst
    tgdglqwgvllgfgpglsietvvlrsmplhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ov3D (D:)
    nlhalrreqraqgpatimaigtatppnlyeqstfpdfyfrvtnsddkqelkkkfrrmcek
    tmvkkrylhlteeilkerpklcsykeasfddrqdivveeiprlakeaaekaikewgrpks
    eithlvfcsisgidmpgadyrlatllglpltvnrlmiysqachmgaamlriakdlaennr
    garvlvvaceitvlsfrgpnegdfealafqagfgdgagavvvgadplegiekpiyeiaaa
    mqetvaesqgavgghlrafgwtfyflnqlpaiiadnlgrsleralaplgvrewndvfwva
    hpgnwaiidaieaklqlspdklstarhvfteygnmqsatvyfvmdelrkrsavegrsttg
    dglqwgvllgfgpglsietvvlrsmplhh