PDB entry 3ov2

View 3ov2 on RCSB PDB site
Description: Curcumin synthase 1 from Curcuma longa
Class: transferase
Keywords: type III polyketide synthase, TRANSFERASE
Deposited on 2010-09-15, released 2010-12-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.186
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Curcumin synthase
    Species: Curcuma longa [TaxId:136217]
    Gene: CURS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0SVZ6 (Start-388)
      • expression tag (389-390)
    Domains in SCOPe 2.06: d3ov2a1, d3ov2a2, d3ov2a3
  • Chain 'B':
    Compound: Curcumin synthase
    Species: Curcuma longa [TaxId:136217]
    Gene: CURS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0SVZ6 (Start-388)
      • expression tag (389-390)
    Domains in SCOPe 2.06: d3ov2b1, d3ov2b2, d3ov2b3
  • Chain 'C':
    Compound: Curcumin synthase
    Species: Curcuma longa [TaxId:136217]
    Gene: CURS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0SVZ6 (Start-388)
      • expression tag (389-392)
    Domains in SCOPe 2.06: d3ov2c1, d3ov2c2, d3ov2c3
  • Chain 'D':
    Compound: Curcumin synthase
    Species: Curcuma longa [TaxId:136217]
    Gene: CURS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0SVZ6 (Start-388)
      • expression tag (389-390)
    Domains in SCOPe 2.06: d3ov2d1, d3ov2d2, d3ov2d3
  • Heterogens: MLI, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ov2A (A:)
    manlhalrreqraqgpatimaigtatppnlyeqstfpdfyfrvtnsddkqelkkkfrrmc
    ektmvkkrylhlteeilkerpklcsykeasfddrqdivveeiprlakeaaekaikewgrp
    kseithlvfcsisgidmpgadyrlatllglpltvnrlmiysqachmgaamlriakdlaen
    nrgarvlvvaceitvlsfrgpnegdfealagqagfgdgagavvvgadplegiekpiyeia
    aamqetvaesqgavgghlrafgwtfyflnqlpaiiadnlgrsleralaplgvrewndvfw
    vahpgnwaiidaieaklqlspdklstarhvfteygnmqsatvyfvmdelrkrsavegrst
    tgdglqwgvllgfgpglsietvvlrsmplhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ov2A (A:)
    nlhalrreqraqgpatimaigtatppnlyeqstfpdfyfrvtnsddkqelkkkfrrmcek
    tmvkkrylhlteeilkerpklcsykeasfddrqdivveeiprlakeaaekaikewgrpks
    eithlvfcsisgidmpgadyrlatllglpltvnrlmiysqachmgaamlriakdlaennr
    garvlvvaceitvlsfrgpnegdfealagqagfgdgagavvvgadplegiekpiyeiaaa
    mqetvaesqgavgghlrafgwtfyflnqlpaiiadnlgrsleralaplgvrewndvfwva
    hpgnwaiidaieaklqlspdklstarhvfteygnmqsatvyfvmdelrkrsavegrsttg
    dglqwgvllgfgpglsietvvlrsmplhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ov2B (B:)
    manlhalrreqraqgpatimaigtatppnlyeqstfpdfyfrvtnsddkqelkkkfrrmc
    ektmvkkrylhlteeilkerpklcsykeasfddrqdivveeiprlakeaaekaikewgrp
    kseithlvfcsisgidmpgadyrlatllglpltvnrlmiysqachmgaamlriakdlaen
    nrgarvlvvaceitvlsfrgpnegdfealagqagfgdgagavvvgadplegiekpiyeia
    aamqetvaesqgavgghlrafgwtfyflnqlpaiiadnlgrsleralaplgvrewndvfw
    vahpgnwaiidaieaklqlspdklstarhvfteygnmqsatvyfvmdelrkrsavegrst
    tgdglqwgvllgfgpglsietvvlrsmplhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ov2B (B:)
    nlhalrreqraqgpatimaigtatppnlyeqstfpdfyfrvtnsddkqelkkkfrrmcek
    tmvkkrylhlteeilkerpklcsykeasfddrqdivveeiprlakeaaekaikewgrpks
    eithlvfcsisgidmpgadyrlatllglpltvnrlmiysqachmgaamlriakdlaennr
    garvlvvaceitvlsfrgpnegdfealagqagfgdgagavvvgadplegiekpiyeiaaa
    mqetvaesqgavgghlrafgwtfyflnqlpaiiadnlgrsleralaplgvrewndvfwva
    hpgnwaiidaieaklqlspdklstarhvfteygnmqsatvyfvmdelrkrsavegrsttg
    dglqwgvllgfgpglsietvvlrsmplhh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ov2C (C:)
    manlhalrreqraqgpatimaigtatppnlyeqstfpdfyfrvtnsddkqelkkkfrrmc
    ektmvkkrylhlteeilkerpklcsykeasfddrqdivveeiprlakeaaekaikewgrp
    kseithlvfcsisgidmpgadyrlatllglpltvnrlmiysqachmgaamlriakdlaen
    nrgarvlvvaceitvlsfrgpnegdfealagqagfgdgagavvvgadplegiekpiyeia
    aamqetvaesqgavgghlrafgwtfyflnqlpaiiadnlgrsleralaplgvrewndvfw
    vahpgnwaiidaieaklqlspdklstarhvfteygnmqsatvyfvmdelrkrsavegrst
    tgdglqwgvllgfgpglsietvvlrsmplhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ov2C (C:)
    anlhalrreqraqgpatimaigtatppnlyeqstfpdfyfrvtnsddkqelkkkfrrmce
    ktmvkkrylhlteeilkerpklcsykeasfddrqdivveeiprlakeaaekaikewgrpk
    seithlvfcsisgidmpgadyrlatllglpltvnrlmiysqachmgaamlriakdlaenn
    rgarvlvvaceitvlsfrgpnegdfealagqagfgdgagavvvgadplegiekpiyeiaa
    amqetvaesqgavgghlrafgwtfyflnqlpaiiadnlgrsleralaplgvrewndvfwv
    ahpgnwaiidaieaklqlspdklstarhvfteygnmqsatvyfvmdelrkrsavegrstt
    gdglqwgvllgfgpglsietvvlrsmplhhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ov2D (D:)
    manlhalrreqraqgpatimaigtatppnlyeqstfpdfyfrvtnsddkqelkkkfrrmc
    ektmvkkrylhlteeilkerpklcsykeasfddrqdivveeiprlakeaaekaikewgrp
    kseithlvfcsisgidmpgadyrlatllglpltvnrlmiysqachmgaamlriakdlaen
    nrgarvlvvaceitvlsfrgpnegdfealagqagfgdgagavvvgadplegiekpiyeia
    aamqetvaesqgavgghlrafgwtfyflnqlpaiiadnlgrsleralaplgvrewndvfw
    vahpgnwaiidaieaklqlspdklstarhvfteygnmqsatvyfvmdelrkrsavegrst
    tgdglqwgvllgfgpglsietvvlrsmplhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ov2D (D:)
    nlhalrreqraqgpatimaigtatppnlyeqstfpdfyfrvtnsddkqelkkkfrrmcek
    tmvkkrylhlteeilkerpklcsykeasfddrqdivveeiprlakeaaekaikewgrpks
    eithlvfcsisgidmpgadyrlatllglpltvnrlmiysqachmgaamlriakdlaennr
    garvlvvaceitvlsfrgpnegdfealagqagfgdgagavvvgadplegiekpiyeiaaa
    mqetvaesqgavgghlrafgwtfyflnqlpaiiadnlgrsleralaplgvrewndvfwva
    hpgnwaiidaieaklqlspdklstarhvfteygnmqsatvyfvmdelrkrsavegrsttg
    dglqwgvllgfgpglsietvvlrsmplhh