PDB entry 3ov1
View 3ov1 on RCSB PDB site
Description: Crystal Structure of the Grb2 SH2 Domain in Complex with a pYXN-Derived Tripeptide
Class: signaling protein/antagonist
Keywords: Grb2 SH2 Domain, Phosphotyrosine Binding, SIGNALING PROTEIN, SIGNALING PROTEIN-ANTAGONIST complex
Deposited on
2010-09-15, released
2011-11-02
The last revision prior to the SCOPe 2.03 freeze date was dated
2011-12-07, with a file datestamp of
2011-12-02.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.164
AEROSPACI score: 0.62
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Growth factor receptor-bound protein 2
Species: Homo sapiens [TaxId:9606]
Gene: GRB2, ASH
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.03: d3ov1a_ - Chain 'B':
Compound: pyac3cn
Database cross-references and differences (RAF-indexed):
- Heterogens: GOL, FMT, NA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3ov1A (A:)
iemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlr
dgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqahhhhhh
Sequence, based on observed residues (ATOM records): (download)
>3ov1A (A:)
mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpq
- Chain 'B':
No sequence available.