PDB entry 3ouu

View 3ouu on RCSB PDB site
Description: Crystal Structure of Biotin Carboxylase-beta-gamma-ATP Complex from Campylobacter jejuni
Class: ligase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, alpha - beta fold, carboxylase, cytosol, LIGASE
Deposited on 2010-09-15, released 2010-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.172
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin carboxylase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: accC, Cj1290c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0P8W7 (3-445)
      • expression tag (0-2)
    Domains in SCOPe 2.06: d3ouua1, d3ouua2, d3ouua3, d3ouua4
  • Chain 'B':
    Compound: biotin carboxylase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: accC, Cj1290c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3ouub1, d3ouub2, d3ouub3
  • Heterogens: GOL, CA, ANP, CAC, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ouuA (A:)
    snameiksilianrgeialralrtikemgkkaicvyseadkdalylkyadasicigkars
    sesylnipaiiaaaeiaeadaifpgygflsenqnfveicakhnikfigpsveamnlmsdk
    skakqvmqragvpvipgsdgalagaeaakklakeigypvilkaaaggggrgmrvvenekd
    lekaywsaeseamtafgdgtmymekyiqnprhievqvigdsfgnvihvgerdcsmqrrhq
    klieespailldektrtrlhetaikaakaigyegagtfeflvdknldfyfiemntrlqve
    hcvsemvsgidiieqmikvaegyalpsqesiklnghsiecritaedsktflpspgkitky
    ippagrnvrmeshcyqdysvpayydsmigklvvwaedrnkaiakmkvaldellisgiktt
    kdfhlsmmenpdfinnnydtnylarh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ouuB (B:)
    snameiksilianrgeialralrtikemgkkaicvyseadkdalylkyadasicigkars
    sesylnipaiiaaaeiaeadaifpgygflsenqnfveicakhnikfigpsveamnlmsdk
    skakqvmqragvpvipgsdgalagaeaakklakeigypvilkaaaggggrgmrvvenekd
    lekaywsaeseamtafgdgtmymekyiqnprhievqvigdsfgnvihvgerdcsmqrrhq
    klieespailldektrtrlhetaikaakaigyegagtfeflvdknldfyfiemntrlqve
    hcvsemvsgidiieqmikvaegyalpsqesiklnghsiecritaedsktflpspgkitky
    ippagrnvrmeshcyqdysvpayydsmigklvvwaedrnkaiakmkvaldellisgiktt
    kdfhlsmmenpdfinnnydtnylarh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ouuB (B:)
    meiksilianrgeialralrtikemgkkaicvyseadkdalylkyadasicigkarsses
    ylnipaiiaaaeiaeadaifpgygflsenqnfveicakhnikfigpsveamnlmsdkska
    kqvmqragvpvipgsdgalagaeaakklakeigypvilkaaaggggrgmrvvenekdlek
    aywsaeseamtafgdgtmymekyiqnprhievqvigdsfgnvihvgerdcsmqrrhqkli
    eespailldektrtrlhetaikaakaigyegagtfeflvdknldfyfiemntrlqvehcv
    semvsgidiieqmikvaegyalpsqesiklnghsiecritaedsktflpspgkitkyipp
    agrnvrmeshcyqdysvpayydsmigklvvwaedrnkaiakmkvaldellisgikttkdf
    hlsmmenpdfinnnydtnylarh