SCOPe 2.06: Structural Classification of Proteins

PDB entry 3orx

View 3orx on RCSB PDB site
Description: PDK1 mutant bound to allosteric disulfide fragment inhibitor 1F8
Class: transferase/transferase inhibitor
Keywords: PIF pocket, C-helix, activation loop, AGC kinase, Transferase, Allosteric inhibitor, Phosphorylation, allostery, disulfide, kinase, PDK1, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-09-08, released 2011-03-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-04-27, with a file datestamp of 2011-04-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: 3-phosphoinositide-dependent protein kinase 1
Species: Homo sapiens [TaxId:9606]
Gene: PDK1, PDPK1
Database cross-references and differences (RAF-indexed):
- Uniprot O15530 (Start-315)
  - engineered mutation (104)
Domains in SCOPe 2.06: d3orxa_
Chain 'B':
Compound: 3-phosphoinositide-dependent protein kinase 1
Species: Homo sapiens [TaxId:9606]
Gene: PDK1, PDPK1
Database cross-references and differences (RAF-indexed):
- Uniprot O15530 (Start-315)
  - engineered mutation (104)
Domains in SCOPe 2.06: d3orxb_
Chain 'C':
Compound: 3-phosphoinositide-dependent protein kinase 1
Species: Homo sapiens [TaxId:9606]
Gene: PDK1, PDPK1
Database cross-references and differences (RAF-indexed):
- Uniprot O15530 (Start-315)
  - engineered mutation (104)
Domains in SCOPe 2.06: d3orxc_
Chain 'D':
Compound: 3-phosphoinositide-dependent protein kinase 1
Species: Homo sapiens [TaxId:9606]
Gene: PDK1, PDPK1
Database cross-references and differences (RAF-indexed):
- Uniprot O15530 (Start-315)
  - engineered mutation (104)
Domains in SCOPe 2.06: d3orxd_
Chain 'E':
Compound: 3-phosphoinositide-dependent protein kinase 1
Species: Homo sapiens [TaxId:9606]
Gene: PDK1, PDPK1
Database cross-references and differences (RAF-indexed):
- Uniprot O15530 (Start-315)
  - engineered mutation (104)
Domains in SCOPe 2.06: d3orxe_
Chain 'F':
Compound: 3-phosphoinositide-dependent protein kinase 1
Species: Homo sapiens [TaxId:9606]
Gene: PDK1, PDPK1
Database cross-references and differences (RAF-indexed):
- Uniprot O15530 (Start-315)
  - engineered mutation (104)
Domains in SCOPe 2.06: d3orxf_
Chain 'G':
Compound: 3-phosphoinositide-dependent protein kinase 1
Species: Homo sapiens [TaxId:9606]
Gene: PDK1, PDPK1
Database cross-references and differences (RAF-indexed):
- Uniprot O15530 (Start-315)
  - engineered mutation (104)
Domains in SCOPe 2.06: d3orxg_
Chain 'H':
Compound: 3-phosphoinositide-dependent protein kinase 1
Species: Homo sapiens [TaxId:9606]
Gene: PDK1, PDPK1
Database cross-references and differences (RAF-indexed):
- Uniprot O15530 (Start-315)
  - engineered mutation (104)
Domains in SCOPe 2.06: d3orxh_
Heterogens: 1F8, CL, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3orxA (A:)
gamdpefmdgtaaeprpgagslqhaqpppqprkkrpedfkfgkilgegsfstvvlarela
tsreyaikilekrhiikenkvpyvtrerdvmsrldhpffvklyfcfqddeklyfglsyak
ngellkyirkigsfdetctrfytaeivsaleylhgkgiihrdlkpenillnedmhiqitd
fgtakvlspeskqaransfvgtaqyvspellteksackssdlwalgciiyqlvaglppfr
agneylifqkiikleydfpekffpkardlvekllvldatkrlgceemegygplkahpffe
svtwenlhqqtppklt