PDB entry 3orv

View 3orv on RCSB PDB site
Description: Crystal Structure of the Y294H-MauG/pre-Methylamine Dehydrogenase Complex
Class: oxidoreductase/electron transport
Keywords: MauG, methylamine dehydrogenase, His-His heme, c-heme, quinone cofactor, OXIDOREDUCTASE-ELECTRON TRANSPORT complex
Deposited on 2010-09-07, released 2010-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.141
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylamine utilization protein MauG
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: mauG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51658
      • engineered mutation (293)
  • Chain 'B':
    Compound: Methylamine utilization protein MauG
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: mauG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51658
      • engineered mutation (293)
  • Chain 'C':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: mauA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3orvc_
  • Chain 'D':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4730
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3orvd_
  • Chain 'E':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: mauA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3orve_
  • Chain 'F':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4730
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3orvf_
  • Heterogens: CA, HEC, EDO, PGE, PEG, PG4, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3orvC (C:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3orvC (C:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3orvD (D:)
    qdapeaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtq
    qfvidgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtll
    ptadielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpd
    cyhifptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrl
    vwptytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdq
    rdewrhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihd
    aesgeelrsvnqlghgpqvittadmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3orvD (D:)
    qetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagr
    vigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpda
    prflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapd
    tffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkih
    qidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktas
    rfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsv
    nqlghgpqvittadmg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3orvE (E:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3orvE (E:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgka
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3orvF (F:)
    qdapeaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtq
    qfvidgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtll
    ptadielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpd
    cyhifptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrl
    vwptytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdq
    rdewrhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihd
    aesgeelrsvnqlghgpqvittadmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3orvF (F:)
    qetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagr
    vigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpda
    prflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapd
    tffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkih
    qidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktas
    rfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsv
    nqlghgpqvittadmg